Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 5601
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol MAPK9   Gene   UCSC   Ensembl
Aliases JNK-55, JNK2, JNK2A, JNK2ALPHA, JNK2B, JNK2BETA, PRKM9, SAPK, SAPK1a, p54a, p54aSAPK
Gene name mitogen-activated protein kinase 9
Alternate names mitogen-activated protein kinase 9, Jun kinase, MAP kinase 9, MAPK 9, c-Jun N-terminal kinase 2, c-Jun kinase 2, stress-activated protein kinase 1a, stress-activated protein kinase JNK2,
Gene location 5q35.3 (180292082: 180233142)     Exons: 17     NC_000005.10
Gene summary(Entrez) The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription
OMIM 602896

Protein Summary
Protein general information P45984  

Name: Mitogen activated protein kinase 9 (MAP kinase 9) (MAPK 9) (EC 2.7.11.24) (JNK 55) (Stress activated protein kinase 1a) (SAPK1a) (Stress activated protein kinase JNK2) (c Jun N terminal kinase 2)

Length: 424  Mass: 48139

Sequence MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELV
LLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIHMELDHERMSYLLYQMLCGIKHLHSAGIIHR
DLKPSNIVVKSDCTLKILDFGLARTACTNFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIF
QGTDHIDQWNKVIEQLGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEVMDWEERSKNGVVKDQ
PSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPLEGCR
Structural information
Protein Domains
 (26..32-)
(/note="Protein-kinase)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
Interpro:  IPR011009  IPR003527  IPR008351  IPR000719  IPR008271  
Prosite:   PS01351 PS50011 PS00108

PDB:  		 3E7O 3NPC
PDBsum:   3E7O 3NPC

DIP:  
270
MINT:  
STRING:   ENSP00000394560
Other Databases GeneCards:  MAPK9  Malacards:  MAPK9

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0007254 JNK cascade
 IBA biological process
GO:0004707 MAP kinase activity
 IBA molecular function
GO:0035556 intracellular signal tran
sduction
 IBA biological process
GO:0010468 regulation of gene expres
sion
 IBA biological process
GO:0005737 cytoplasm
 IBA cellular component
GO:0005634 nucleus
 IBA cellular component
GO:0004705 JUN kinase activity
 IBA molecular function
GO:0042752 regulation of circadian r
hythm
 ISS biological process
GO:0006468 protein phosphorylation
 IMP biological process
GO:0005515 protein binding
 IPI molecular function
GO:0004707 MAP kinase activity
 IEA molecular function
GO:0004672 protein kinase activity
 IEA molecular function
GO:0005524 ATP binding
 IEA molecular function
GO:0006468 protein phosphorylation
 IEA biological process
GO:0016740 transferase activity
 IEA molecular function
GO:0048511 rhythmic process
 IEA biological process
GO:0016301 kinase activity
 IEA molecular function
GO:0004674 protein serine/threonine
kinase activity
 IEA molecular function
GO:0005524 ATP binding
 IEA molecular function
GO:0000166 nucleotide binding
 IEA molecular function
GO:0005634 nucleus
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0016310 phosphorylation
 IEA biological process
GO:0004707 MAP kinase activity
 IEA molecular function
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0007254 JNK cascade
 TAS biological process
GO:0038095 Fc-epsilon receptor signa
ling pathway
 TAS biological process
GO:0051090 regulation of DNA-binding
transcription factor act
ivity
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0004712 protein serine/threonine/
tyrosine kinase activity
 IEA molecular function
GO:0005829 cytosol
 IEA cellular component
GO:0018105 peptidyl-serine phosphory
lation
 IEA biological process
GO:0046686 response to cadmium ion
 IEA biological process
GO:0071803 positive regulation of po
dosome assembly
 IEA biological process
GO:0004672 protein kinase activity
 IEA molecular function
GO:0005737 cytoplasm
 IEA cellular component
GO:0005739 mitochondrion
 IEA cellular component
GO:0006468 protein phosphorylation
 IEA biological process
GO:0031398 positive regulation of pr
otein ubiquitination
 IEA biological process
GO:0042752 regulation of circadian r
hythm
 IEA biological process
GO:0061833 protein localization to t
ricellular tight junction
 IEA biological process
GO:1901485 positive regulation of tr
anscription factor catabo
lic process
 IEA biological process
GO:2001235 positive regulation of ap
optotic signaling pathway
 IEA biological process
GO:0010628 positive regulation of ge
ne expression
 IMP biological process
GO:0010744 positive regulation of ma
crophage derived foam cel
l differentiation
 IMP biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0007258 JUN phosphorylation
 IEA biological process
GO:0007258 JUN phosphorylation
 IEA biological process
GO:0034614 cellular response to reac
tive oxygen species
 IMP biological process
GO:0071276 cellular response to cadm
ium ion
 IMP biological process
GO:0018105 peptidyl-serine phosphory
lation
 IDA biological process
GO:0007254 JNK cascade
 IDA biological process
GO:0008134 transcription factor bind
ing
 IDA molecular function
GO:0004705 JUN kinase activity
 IDA molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05200Pathways in cancer
hsa05010Alzheimer disease
hsa05016Huntington disease
hsa04010MAPK signaling pathway
hsa05012Parkinson disease
hsa05131Shigellosis
hsa04014Ras signaling pathway
hsa05132Salmonella infection
hsa04024cAMP signaling pathway
hsa05166Human T-cell leukemia virus 1 infection
hsa04510Focal adhesion
hsa05130Pathogenic Escherichia coli infection
hsa05170Human immunodeficiency virus 1 infection
hsa04141Protein processing in endoplasmic reticulum
hsa05169Epstein-Barr virus infection
hsa04310Wnt signaling pathway
hsa05167Kaposi sarcoma-associated herpesvirus infection
hsa04530Tight junction
hsa04621NOD-like receptor signaling pathway
hsa04723Retrograde endocannabinoid signaling
hsa05017Spinocerebellar ataxia
hsa04140Autophagy - animal
hsa05152Tuberculosis
hsa04217Necroptosis
hsa04932Non-alcoholic fatty liver disease
hsa04910Insulin signaling pathway
hsa05161Hepatitis B
hsa04728Dopaminergic synapse
hsa04380Osteoclast differentiation
hsa05418Fluid shear stress and atherosclerosis
hsa05135Yersinia infection
hsa04210Apoptosis
hsa04926Relaxin signaling pathway
hsa04722Neurotrophin signaling pathway
hsa04071Sphingolipid signaling pathway
hsa04068FoxO signaling pathway
hsa04935Growth hormone synthesis, secretion and action
hsa05162Measles
hsa05231Choline metabolism in cancer
hsa04668TNF signaling pathway
hsa04625C-type lectin receptor signaling pathway
hsa04660T cell receptor signaling pathway
hsa04931Insulin resistance
hsa04750Inflammatory mediator regulation of TRP channels
hsa04659Th17 cell differentiation
hsa04620Toll-like receptor signaling pathway
hsa05145Toxoplasmosis
hsa04914Progesterone-mediated oocyte maturation
hsa04912GnRH signaling pathway
hsa05142Chagas disease
hsa04658Th1 and Th2 cell differentiation
hsa04012ErbB signaling pathway
hsa04933AGE-RAGE signaling pathway in diabetic complications
hsa01522Endocrine resistance
hsa04657IL-17 signaling pathway
hsa04137Mitophagy - animal
hsa05210Colorectal cancer
hsa05120Epithelial cell signaling in Helicobacter pylori infection
hsa04622RIG-I-like receptor signaling pathway
hsa04920Adipocytokine signaling pathway
hsa04664Fc epsilon RI signaling pathway
hsa05212Pancreatic cancer
hsa05133Pertussis
hsa04917Prolactin signaling pathway
hsa04930Type II diabetes mellitus
hsa04215Apoptosis - multiple species
P06959CCKR signaling map
P06959CCKR signaling map
P06959CCKR signaling map
P06959CCKR signaling map
P06959CCKR signaling map
P06959CCKR signaling map
P06959CCKR signaling map

Diseases

Expand All | Collapse All
Associated diseases References
Semen quality MIK: 26209830
Sperm motility MIK: 26209830
Male factor infertility MIK: 26209830
Alzheimer's disease PMID:11208906
pancreatic adenocarcinoma PMID:22517435
colorectal cancer PMID:25205654
type 2 diabetes mellitus PMID:21911753
Cryptorchidism MIK: 28606200
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
28606200 Cryptorchi
dism
Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
 Male infertility MeDIP-Seq
 Show abstract