• Gene id: 56005

Gene Summary

• Gene Symbol: MYDGF   Gene   UCSC   Ensembl
• Aliases: C19orf10, EUROIMAGE1875335, IL25, IL27, IL27w, R33729_1, SF20
• Gene name: myeloid derived growth factor
• Alternate names: myeloid-derived growth factor, UPF0556 protein C19orf10, interleukin 27 working designation, interleukin-25, stromal cell-derived growth factor SF20,
• Gene location: 19p13.3 (4670390: 4657544)     Exons: 7     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene was previously thought to support proliferation of lymphoid cells and was considered an interleukin. However, this activity has not been reproducible and the function of this protein is currently unknown. [provided by RefS
• OMIM: 606746

Protein Summary

• Protein general information: Q969H8  
  • Name: Myeloid derived growth factor (MYDGF)
  • Length: 173  
  • Mass: 18795
  • Tissue specificity: Expressed in eosinophils (at protein level) (PubMed
• Sequence:

  MAAPSGGWNGVGASLWAALLLGAVALRPAEAVSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNE
  QWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAH
  RPGAFKAELSKLVIVAKASRTEL

• Structural information:
  • Interpro: IPR018887  
  • PDB: 6O6W 6SVK 6SVL
  • PDBsum: 6O6W 6SVK 6SVL
  • STRING: ENSP00000262947
• Other Databases: GeneCards:  MYDGF  Malacards:  MYDGF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001938	positive regulation of endothelial cell proliferation	IBA	biological process
GO:0045766	positive regulation of angiogenesis	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0045766	positive regulation of angiogenesis	IDA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IDA	biological process
GO:0043066	negative regulation of apoptotic process	ISS	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	ISS	biological process
GO:0051897	positive regulation of protein kinase B signaling	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0043410	positive regulation of MAPK cascade	ISS	biological process
GO:0001934	positive regulation of protein phosphorylation	ISS	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0001525	angiogenesis	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0036498	IRE1-mediated unfolded protein response	TAS	biological process
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0051897	positive regulation of protein kinase B signaling	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)