• Gene id: 5600

Gene Summary

• Gene Symbol: MAPK11   Gene   UCSC   Ensembl
• Aliases: P38B, P38BETA2, PRKM11, SAPK2, SAPK2B, p38-2, p38Beta
• Gene name: mitogen-activated protein kinase 11
• Alternate names: mitogen-activated protein kinase 11, MAP kinase 11, MAP kinase p38 beta, mitogen-activated protein kinase p38 beta, mitogen-activated protein kinase p38-2, stress-activated protein kinase-2, stress-activated protein kinase-2b,
• Gene location: 22q13.33 (50270379: 50263712)     Exons: 13     NC_000022.11
• Gene summary(Entrez): This gene encodes a member of a family of protein kinases that are involved in the integration of biochemical signals for a wide variety of cellular processes, including cell proliferation, differentiation, transcriptional regulation, and development. The
• OMIM: 602898

Protein Summary

• Protein general information: Q15759  
  • Name: Mitogen activated protein kinase 11 (MAP kinase 11) (MAPK 11) (EC 2.7.11.24) (Mitogen activated protein kinase p38 beta) (MAP kinase p38 beta) (p38b) (Stress activated protein kinase 2b) (SAPK2b) (p38 2)
  • Length: 364  
  • Mass: 41357
  • Tissue specificity: Highest levels in the brain and heart. Also expressed in the placenta, lung, liver, skeletal muscle, kidney and pancreas.
• Sequence:

  MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLL
  KHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRD
  LKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPG
  SDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAA
  EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ

• Structural information:
  • Protein Domains: (24..30-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR003527  IPR008352  IPR000719  IPR017441  
  • Prosite: PS01351 PS00107 PS50011
  • PDB: 3GC8 3GC9 3GP0
  • PDBsum: 3GC8 3GC9 3GP0
  • STRING: ENSP00000333685
• Other Databases: GeneCards:  MAPK11  Malacards:  MAPK11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004707	MAP kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0004707	MAP kinase activity	IDA	molecular function
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007265	Ras protein signal transduction	TAS	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0051090	regulation of DNA-binding transcription factor activity	TAS	biological process
GO:0051149	positive regulation of muscle cell differentiation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0060044	negative regulation of cardiac muscle cell proliferation	IEA	biological process
GO:0060043	regulation of cardiac muscle cell proliferation	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0045648	positive regulation of erythrocyte differentiation	IMP	NOT|biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004707	MAP kinase activity	IDA	molecular function
GO:0051403	stress-activated MAPK cascade	IDA	biological process
GO:0071347	cellular response to interleukin-1	IDA	biological process
GO:0098586	cellular response to virus	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:2001184	positive regulation of interleukin-12 secretion	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa04714	Thermogenesis
hsa05131	Shigellosis
hsa05132	Salmonella infection
hsa04015	Rap1 signaling pathway
hsa05163	Human cytomegalovirus infection
hsa05130	Pathogenic Escherichia coli infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05205	Proteoglycans in cancer
hsa05169	Epstein-Barr virus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04621	NOD-like receptor signaling pathway
hsa04723	Retrograde endocannabinoid signaling
hsa04261	Adrenergic signaling in cardiomyocytes
hsa05152	Tuberculosis
hsa04218	Cellular senescence
hsa05161	Hepatitis B
hsa04728	Dopaminergic synapse
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa04380	Osteoclast differentiation
hsa05418	Fluid shear stress and atherosclerosis
hsa04114	Oocyte meiosis
hsa05135	Yersinia infection
hsa04611	Platelet activation
hsa04926	Relaxin signaling pathway
hsa04722	Neurotrophin signaling pathway
hsa04071	Sphingolipid signaling pathway
hsa04068	FoxO signaling pathway
hsa04670	Leukocyte transendothelial migration
hsa04935	Growth hormone synthesis, secretion and action
hsa04668	TNF signaling pathway
hsa04625	C-type lectin receptor signaling pathway
hsa04660	T cell receptor signaling pathway
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04659	Th17 cell differentiation
hsa04620	Toll-like receptor signaling pathway
hsa05145	Toxoplasmosis
hsa04914	Progesterone-mediated oocyte maturation
hsa04912	GnRH signaling pathway
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05142	Chagas disease
hsa04658	Th1 and Th2 cell differentiation
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa01522	Endocrine resistance
hsa04657	IL-17 signaling pathway
hsa05120	Epithelial cell signaling in Helicobacter pylori infection
hsa04622	RIG-I-like receptor signaling pathway
hsa04664	Fc epsilon RI signaling pathway
hsa05133	Pertussis
hsa04917	Prolactin signaling pathway
hsa05140	Leishmaniasis
hsa05014	Amyotrophic lateral sclerosis
hsa04370	VEGF signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881