• Gene id: 5599

Gene Summary

• Gene Symbol: MAPK8   Gene   UCSC   Ensembl
• Aliases: JNK, JNK-46, JNK1, JNK1A2, JNK21B1/2, PRKM8, SAPK1, SAPK1c
• Gene name: mitogen-activated protein kinase 8
• Alternate names: mitogen-activated protein kinase 8, JUN N-terminal kinase, MAP kinase 8, c-Jun N-terminal kinase 1, mitogen-activated protein kinase 8 isoform JNK1 alpha1, mitogen-activated protein kinase 8 isoform JNK1 beta2, stress-activated protein kinase 1, stress-ac,
• Gene location: 10q11.22 (48306638: 48439359)     Exons: 16     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription
• OMIM: 601158

Protein Summary

• Protein general information: P45983  
  • Name: Mitogen activated protein kinase 8 (MAP kinase 8) (MAPK 8) (EC 2.7.11.24) (JNK 46) (Stress activated protein kinase 1c) (SAPK1c) (Stress activated protein kinase JNK1) (c Jun N terminal kinase 1)
  • Length: 427  
  • Mass: 48,296
• Sequence:

  MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELV
  LMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHR
  DLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILF
  PGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
  MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLEERTKNGVIRGQ
  PSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAAGPLGCCR

• Structural information:
  • Protein Domains: Protein (26-321)
  • Interpro: IPR011009  IPR003527  IPR008351  IPR000719  IPR008271  
  • Prosite: PS01351 PS50011 PS00108
  • PDB: 1UKH 1UKI 2G01 2GMX 2H96 2NO3 2XRW 2XS0 3ELJ 3O17 3O2M 3PZE 3V3V 3VUD 3VUG 3VUH 3VUI 3VUK 3VUL 3VUM 4AWI 4E73 4G1W 4HYS 4HYU 4IZY 4L7F 4QTD 4UX9 4YR8 5LW1 6F5E
  • PDBsum: 1UKH 1UKI 2G01 2GMX 2H96 2NO3 2XRW 2XS0 3ELJ 3O17 3O2M 3PZE 3V3V 3VUD 3VUG 3VUH 3VUI 3VUK 3VUL 3VUM 4AWI 4E73 4G1W 4HYS 4HYU 4IZY 4L7F 4QTD 4UX9 4YR8 5LW1 6F5E
  • DIP: 249
  • STRING: ENSP00000353483
• Other Databases: GeneCards:  MAPK8  Malacards:  MAPK8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004705	JUN kinase activity	IDA	molecular function
GO:0004705	JUN kinase activity	IDA	molecular function
GO:0004705	JUN kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006468	protein phosphorylation	IMP	biological process
GO:0006950	response to stress	TAS	biological process
GO:0007254	JNK cascade	IDA	biological process
GO:0007254	JNK cascade	TAS	biological process
GO:0007258	JUN phosphorylation	IDA	biological process
GO:0007258	JUN phosphorylation	IDA	biological process
GO:0009411	response to UV	IDA	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IMP	biological process
GO:0018107	peptidyl-threonine phosphorylation	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0031063	regulation of histone deacetylation	IEA	biological process
GO:0031281	positive regulation of cyclase activity	IMP	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032880	regulation of protein localization	IDA	biological process
GO:0035033	histone deacetylase regulator activity	IMP	molecular function
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0043065	positive regulation of apoptotic process	TAS	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0051090	regulation of sequence-specific DNA binding transcription factor activity	TAS	biological process
GO:0051247	positive regulation of protein metabolic process	IMP	biological process
GO:0071222	cellular response to lipopolysaccharide	IDA	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0090045	positive regulation of deacetylase activity	IMP	biological process
GO:1900740	positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:1900740	positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004705	JUN kinase activity	IDA	molecular function
GO:0004705	JUN kinase activity	IDA	molecular function
GO:0004705	JUN kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IMP	biological process
GO:0006950	response to stress	TAS	biological process
GO:0007254	JNK cascade	IDA	biological process
GO:0007254	JNK cascade	TAS	biological process
GO:0007258	JUN phosphorylation	IDA	biological process
GO:0007258	JUN phosphorylation	IDA	biological process
GO:0009411	response to UV	IDA	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IMP	biological process
GO:0018107	peptidyl-threonine phosphorylation	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0031063	regulation of histone deacetylation	IEA	biological process
GO:0031281	positive regulation of cyclase activity	IMP	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032880	regulation of protein localization	IDA	biological process
GO:0035033	histone deacetylase regulator activity	IMP	molecular function
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0043065	positive regulation of apoptotic process	TAS	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0051090	regulation of sequence-specific DNA binding transcription factor activity	TAS	biological process
GO:0051247	positive regulation of protein metabolic process	IMP	biological process
GO:0071222	cellular response to lipopolysaccharide	IDA	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0090045	positive regulation of deacetylase activity	IMP	biological process
GO:1900740	positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:1900740	positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004705	JUN kinase activity	IDA	molecular function
GO:0004705	JUN kinase activity	IDA	molecular function
GO:0004705	JUN kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006468	protein phosphorylation	IMP	biological process
GO:0006950	response to stress	TAS	biological process
GO:0007254	JNK cascade	IDA	biological process
GO:0007254	JNK cascade	TAS	biological process
GO:0007258	JUN phosphorylation	IDA	biological process
GO:0007258	JUN phosphorylation	IDA	biological process
GO:0009411	response to UV	IDA	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IMP	biological process
GO:0018107	peptidyl-threonine phosphorylation	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0031281	positive regulation of cyclase activity	IMP	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032880	regulation of protein localization	IDA	biological process
GO:0035033	histone deacetylase regulator activity	IMP	molecular function
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0043065	positive regulation of apoptotic process	TAS	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0051090	regulation of sequence-specific DNA binding transcription factor activity	TAS	biological process
GO:0051247	positive regulation of protein metabolic process	IMP	biological process
GO:0071222	cellular response to lipopolysaccharide	IDA	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0090045	positive regulation of deacetylase activity	IMP	biological process
GO:1900740	positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:1900740	positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04668	TNF signaling pathway
hsa04068	FoxO signaling pathway
hsa04071	Sphingolipid signaling pathway
hsa04024	cAMP signaling pathway
hsa04140	Autophagy - animal
hsa04137	Mitophagy - animal
hsa04210	Apoptosis
hsa04215	Apoptosis - multiple species
hsa04217	Necroptosis
hsa04510	Focal adhesion
hsa04530	Tight junction
hsa04620	Toll-like receptor signaling pathway
hsa04621	NOD-like receptor signaling pathway
hsa04622	RIG-I-like receptor signaling pathway
hsa04625	C-type lectin receptor signaling pathway
hsa04660	T cell receptor signaling pathway
hsa04658	Th1 and Th2 cell differentiation
hsa04659	Th17 cell differentiation
hsa04657	IL-17 signaling pathway
hsa04664	Fc epsilon RI signaling pathway
hsa04910	Insulin signaling pathway
hsa04920	Adipocytokine signaling pathway
hsa04912	GnRH signaling pathway
hsa04914	Progesterone-mediated oocyte maturation
hsa04917	Prolactin signaling pathway
hsa04926	Relaxin signaling pathway
hsa04728	Dopaminergic synapse
hsa04723	Retrograde endocannabinoid signaling
hsa04722	Neurotrophin signaling pathway
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04380	Osteoclast differentiation
hsa05200	Pathways in cancer
hsa05231	Choline metabolism in cancer
hsa05210	Colorectal cancer
hsa05212	Pancreatic cancer
hsa05418	Fluid shear stress and atherosclerosis
hsa04930	Type II diabetes mellitus
hsa04932	Non-alcoholic fatty liver disease
hsa04931	Insulin resistance
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa05120	Epithelial cell signaling in Helicobacter pylori infection
hsa05130	Pathogenic Escherichia coli infection
hsa05132	Salmonella infection
hsa05131	Shigellosis
hsa05135	Yersinia infection
hsa05133	Pertussis
hsa05152	Tuberculosis
hsa05166	Human T-cell leukemia virus 1 infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05162	Measles
hsa05161	Hepatitis B
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05169	Epstein-Barr virus infection
hsa05145	Toxoplasmosis
hsa05142	Chagas disease
hsa01522	Endocrine resistance

Diseases

Associated diseases	References
Cancer	GAD: 18950845
Cancer (breast)	GAD: 18950845
Diabetes	GAD: 18036196
Male factor infertility	MIK: 26209830
Semen quality	MIK: 26209830
Sperm motility	MIK: 26209830
Spermatogenesis defects	MIK: 17934699
Spermatogenesis	MIK: 17934699
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17934699	Spermatogenesis				Male infertility
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R