• Gene id: 5598

Gene Summary

• Gene Symbol: MAPK7   Gene   UCSC   Ensembl
• Aliases: BMK1, ERK4, ERK5, PRKM7
• Gene name: mitogen-activated protein kinase 7
• Alternate names: mitogen-activated protein kinase 7, BMK-1, BMK1 kinase, ERK-5, MAP kinase 7, MAPK 7, big MAP kinase 1, extracellular-signal-regulated kinase 5,
• Gene location: 17p11.2 (19377720: 19383543)     Exons: 9     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription
• OMIM: 602521

Protein Summary

• Protein general information: Q13164  
  • Name: Mitogen activated protein kinase 7 (MAP kinase 7) (MAPK 7) (EC 2.7.11.24) (Big MAP kinase 1) (BMK 1) (Extracellular signal regulated kinase 5) (ERK 5)
  • Length: 816  
  • Mass: 88386
  • Tissue specificity: Expressed in many adult tissues. Abundant in heart, placenta, lung, kidney and skeletal muscle. Not detectable in liver. {ECO
• Sequence:

  MAEPLKEEDGEDGSAEPPGPVKAEPAHTAASVAAKNLALLKARSFDVTFDVGDEYEIIETIGNGAYGVVSSARRR
  LTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDILRPTVPYGEFKSVYVVLDLMESDLHQIIHS
  SQPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATR
  WYRAPELMLSLHEYTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
  LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCAPPFDFAFDREALTRE
  RIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMPSPWAPSGDCAMESPPPAPPPCPGPAPDTID
  LTLQPPPPVSEPAPPKKDGAISDNTKAALKAALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQ
  ERAKEREKRRQERERKERGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPAAPALTSVPAPAPAPTPTPTPV
  QPTSPPPGPVAQPTGPQPQSAGSTSGPVPQPACPPPGPAPHPTGPPGPIPVPAPPQIATSTSLLAAQSLVPPPGL
  PGSSTPGVLPYFPPGLPPPDAGGAPQSSMSESPDVNLVTQQLSKSQVEDPLPPVFSGTPKGSGAGYGVGFDLEEF
  LNQSFDMGVADGPQDGQADSASLSASLLADWLEGHGMNPADIESLQREIQMDSPMLLADLPDLQDP

• Structural information:
  • Protein Domains: (55..34-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR003527  IPR000719  IPR017441  IPR008271  
  • Prosite: PS01351 PS00107 PS50011 PS00108
  • PDB: 2Q8Y 4B99 4IC7 4IC8 4ZSG 4ZSJ 4ZSL 5BYY 5BYZ 5O7I 6HKM 6HKN
  • PDBsum: 2Q8Y 4B99 4IC7 4IC8 4ZSG 4ZSJ 4ZSL 5BYY 5BYZ 5O7I 6HKM 6HKN
  • STRING: ENSP00000311005
• Other Databases: GeneCards:  MAPK7  Malacards:  MAPK7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016301	kinase activity	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0007411	axon guidance	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070885	negative regulation of calcineurin-NFAT signaling cascade	IEA	biological process
GO:0045765	regulation of angiogenesis	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0018105	peptidyl-serine phosphorylation	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0051019	mitogen-activated protein kinase binding	IPI	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0019933	cAMP-mediated signaling	NAS	biological process
GO:0036003	positive regulation of transcription from RNA polymerase II promoter in response to stress	IMP	biological process
GO:0051247	positive regulation of protein metabolic process	IGI	biological process
GO:0071363	cellular response to growth factor stimulus	IGI	biological process
GO:0071499	cellular response to laminar fluid shear stress	TAS	biological process
GO:0071499	cellular response to laminar fluid shear stress	IMP	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0034115	negative regulation of heterotypic cell-cell adhesion	IGI	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IGI	biological process
GO:0050728	negative regulation of inflammatory response	TAS	biological process
GO:0051344	negative regulation of cyclic-nucleotide phosphodiesterase activity	NAS	biological process
GO:0060761	negative regulation of response to cytokine stimulus	IGI	biological process
GO:0070301	cellular response to hydrogen peroxide	IMP	biological process
GO:1902176	negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	IMP	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IMP	biological process
GO:2001240	negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IGI	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016605	PML body	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0000165	MAPK cascade	IEA	biological process
GO:0000165	MAPK cascade	IEA	biological process
GO:0000165	MAPK cascade	IEA	biological process
GO:0000165	MAPK cascade	IEA	biological process
GO:0071560	cellular response to transforming growth factor beta stimulus	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0004707	MAP kinase activity	IBA	molecular function
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0010468	regulation of gene expression	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0016605	PML body	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa05206	MicroRNAs in cancer
hsa04921	Oxytocin signaling pathway
hsa05418	Fluid shear stress and atherosclerosis
hsa04722	Neurotrophin signaling pathway
hsa04912	GnRH signaling pathway
hsa04540	Gap junction
hsa04657	IL-17 signaling pathway
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Prostate cancer	PMID:18071319
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray