• Gene id: 55974

Gene Summary

• Gene Symbol: SLC50A1   Gene   UCSC   Ensembl
• Aliases: HsSWEET1, RAG1AP1, SCP, SWEET1, slv
• Gene name: solute carrier family 50 member 1
• Alternate names: sugar transporter SWEET1, RAG1-activating protein 1, RP11-540D14.5, RZPDo834D038D, probable sugar transporter RAG1AP1, recombination activating gene 1 activating protein 1, solute carrier family 50 (sugar efflux transporter), member 1, solute carrier family 50 (,
• Gene location: 1q22 (155135374: 155138857)     Exons: 7     NC_000001.11
• OMIM: 300204

Protein Summary

• Protein general information: Q9BRV3  
  • Name: Sugar transporter SWEET1 (HsSWEET1) (RAG1 activating protein 1) (Solute carrier family 50 member 1) (Stromal cell protein)
  • Length: 221  
  • Mass: 25030
  • Tissue specificity: Ubiquitously expressed with highest expression in oviduct, epididymis and intestine. {ECO
• Sequence:

  MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDGILIVVNTV
  GAALQTLYILAYLHYCPRKRVVLLQTATLLGVLLLGYGYFWLLVPNPEARLQQLGLFCSVFTISMYLSPLADLAK
  VIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFPGIVTSFIRFWLFWKYPQEQDRNYWLLQT

• Structural information:
  • Protein Domains: (10..9-)
    (/note="MtN3/slv-1)
    (127..21-)
    (/note="MtN3/slv-2")
  • Interpro: IPR004316  
  • STRING: ENSP00000357389
• Other Databases: GeneCards:  SLC50A1  Malacards:  SLC50A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051119	sugar transmembrane transporter activity	IBA	molecular function
GO:0016021	integral component of membrane	IBA	cellular component
GO:0008643	carbohydrate transport	IBA	biological process
GO:0008643	carbohydrate transport	IBA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0042947	glucoside transmembrane transporter activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0012505	endomembrane system	ISS	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0008643	carbohydrate transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0008645	hexose transmembrane transport	TAS	biological process
GO:0051119	sugar transmembrane transporter activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0012505	endomembrane system	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0042946	glucoside transport	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881