• Gene id: 55973

Gene Summary

• Gene Symbol: BCAP29   Gene   UCSC   Ensembl
• Aliases: BAP29
• Gene name: B cell receptor associated protein 29
• Alternate names: B-cell receptor-associated protein 29, BCR-associated protein 29,
• Gene location: 7q22.3 (107580006: 107623316)     Exons: 13     NC_000007.14
• OMIM: 0

Protein Summary

• Protein general information: Q9UHQ4  
  • Name: B cell receptor associated protein 29 (BCR associated protein 29) (Bap29)
  • Length: 241  
  • Mass: 28320
• Sequence:

  MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLIVLFLDAVREVRKYSS
  VHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLITQLAKELSNKGVLKTQAENTNKAAKK
  FMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKE
  HSELQDRLERGNKKRL

• Structural information:
  • Interpro: IPR008417  IPR040463  IPR041672  
  • PDB: 4W7Y 4W7Z 4W80
  • PDBsum: 4W7Y 4W7Z 4W80
  • STRING: ENSP00000368414
• Other Databases: GeneCards:  BCAP29  Malacards:  BCAP29

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0070973	protein localization to endoplasmic reticulum exit site	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006886	intracellular protein transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0070973	protein localization to endoplasmic reticulum exit site	IEA	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0001649	osteoblast differentiation	HDA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray