• Gene id: 55970

Gene Summary

• Gene Symbol: GNG12   Gene   UCSC   Ensembl
• Gene name: G protein subunit gamma 12
• Alternate names: guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12, G-protein gamma-12 subunit, guanine nucleotide binding protein (G protein), gamma 12,
• Gene location: 1p31.3 (67833466: 67701474)     Exons: 6     NC_000001.11
• OMIM: 608863

Protein Summary

• Protein general information: Q9UBI6  
  • Name: Guanine nucleotide binding protein G(I)/G(S)/G(O) subunit gamma 12
  • Length: 72  
  • Mass: 8006
• Sequence:

  MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSENPFKDKKTCIIL

• Structural information:
  • Interpro: IPR015898  IPR036284  IPR001770  
  • Prosite: PS50058
  • CDD: cd00068
  • STRING: ENSP00000360021
• Other Databases: GeneCards:  GNG12  Malacards:  GNG12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031681	G-protein beta-subunit binding	IBA	molecular function
GO:0031680	G-protein beta/gamma-subunit complex	IBA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005834	heterotrimeric G-protein complex	IBA	cellular component
GO:0003924	GTPase activity	IEA	molecular function
GO:0005834	heterotrimeric G-protein complex	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0030165	PDZ domain binding	IDA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042301	phosphate ion binding	IEA	molecular function
GO:0005884	actin filament	IEA	cellular component
GO:0021987	cerebral cortex development	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04810	Regulation of actin cytoskeleton
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa05034	Alcoholism
hsa05170	Human immunodeficiency virus 1 infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04723	Retrograde endocannabinoid signaling
hsa04371	Apelin signaling pathway
hsa04728	Dopaminergic synapse
hsa04724	Glutamatergic synapse
hsa04926	Relaxin signaling pathway
hsa04725	Cholinergic synapse
hsa04726	Serotonergic synapse
hsa05032	Morphine addiction
hsa04727	GABAergic synapse
hsa04713	Circadian entrainment

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray