• Gene id: 55966

Gene Summary

• Gene Symbol: AJAP1   Gene   UCSC   Ensembl
• Aliases: MOT8, SHREW-1, SHREW1
• Gene name: adherens junctions associated protein 1
• Alternate names: adherens junction-associated protein 1, membrane protein shrew-1, transmembrane protein SHREW1,
• Gene location: 1p36.32 (4654608: 4792533)     Exons: 8     NC_000001.11
• OMIM: 602899

Protein Summary

• Protein general information: Q9UKB5  
  • Name: Adherens junction associated protein 1 (Membrane protein shrew 1)
  • Length: 411  
  • Mass: 44536
  • Tissue specificity: Expressed in uterus and pancreas (at protein level). {ECO
• Sequence:

  MWIQQLLGLSSMSIRWPGRPLGSHAWILIAMFQLAVDLPACEALGPGPEFWLLPRSPPRPPRLWSFRSGQPARVP
  APVWSPRPPRVERIHGQMQMPRARRAHRPRDQAAALVPKAGLAKPPAAAKSSPSLASSSSSSSSAVAGGAPEQQA
  LLRRGKRHLQGDGLSSFDSRGSRPTTETEFIAWGPTGDEEALESNTFPGVYGPTTVSILQTRKTTVAATTTTTTT
  ATPMTLQTKGFTESLDPRRRIPGGVSTTEPSTSPSNNGEVTQPPRILGEASGLAVHQIITITVSLIMVIAALITT
  LVLKNCCAQSGNTRRNSHQRKTNQQEESCQNLTDFPSARVPSSLDIFTAYNETLQCSHECVRASVPVYTDETLHS
  TTGEYKSTFNGNRPSSSDRHLIPVAFVSEKWFEISC

• Structural information:
  • Interpro: IPR039239  IPR029198  
  • STRING: ENSP00000367433
• Other Databases: GeneCards:  AJAP1  Malacards:  AJAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0044214	spanning component of plasma membrane	IBA	cellular component
GO:0009898	cytoplasmic side of plasma membrane	IBA	cellular component
GO:0008013	beta-catenin binding	IBA	molecular function
GO:0005912	adherens junction	IBA	cellular component
GO:0044291	cell-cell contact zone	IBA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0030860	regulation of polarized epithelial cell differentiation	IDA	biological process
GO:0044214	spanning component of plasma membrane	IDA	cellular component
GO:0001953	negative regulation of cell-matrix adhesion	IDA	biological process
GO:0044291	cell-cell contact zone	IDA	cellular component
GO:0061045	negative regulation of wound healing	IDA	biological process
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0009898	cytoplasmic side of plasma membrane	IDA	cellular component
GO:0005912	adherens junction	IDA	cellular component
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray