• Gene id: 55959

Gene Summary

• Gene Symbol: SULF2   Gene   UCSC   Ensembl
• Aliases: HSULF-2
• Gene name: sulfatase 2
• Alternate names: extracellular sulfatase Sulf-2,
• Gene location: 20q13.12 (47786615: 47654568)     Exons: 24     NC_000020.11
• Gene summary(Entrez): Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF2, selectively remove 6-O-sulfate groups from heparan su
• OMIM: 602897

Protein Summary

• Protein general information: Q8IWU5  
  • Name: Extracellular sulfatase Sulf 2 (hSulf 2) (EC 3.1.6. )
  • Length: 870  
  • Mass: 100455
  • Tissue specificity: Expressed at highest levels in the ovary, skeletal muscle, stomach, brain, uterus, heart, kidney and placenta.
• Sequence:

  MGPPSLVLCLLSATVFSLLGGSSAFLSHHRLKGRFQRDRRNIRPNIILVLTDDQDVELGSMQVMNKTRRIMEQGG
  AHFINAFVTTPMCCPSRSSILTGKYVHNHNTYTNNENCSSPSWQAQHESRTFAVYLNSTGYRTAFFGKYLNEYNG
  SYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDSVSFFRTSKKMYPHRPVLMVISHAAP
  HGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSVDDSMETIYNM
  LVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGL
  DIPADMDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAE
  YQTACEQLGQKWQCVEDATGKLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKK
  KYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPRNLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVT
  HRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRGHLKKKRPEECDCHKISYHTQHKGRL
  KHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPFWTLGPFCACT
  SANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPR
  TRNMDLGLKDGGSYEQYRQFQRRKWPEMKRPSSKSLGQLWEGWEG

• Structural information:
  • Interpro: IPR017850  IPR014615  IPR024609  IPR024607  IPR000917  
  • Prosite: PS00523
  • STRING: ENSP00000353007
• Other Databases: GeneCards:  SULF2  Malacards:  SULF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030201	heparan sulfate proteoglycan metabolic process	IBA	biological process
GO:0030177	positive regulation of Wnt signaling pathway	IBA	biological process
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0040037	negative regulation of fibroblast growth factor receptor signaling pathway	IBA	biological process
GO:0032836	glomerular basement membrane development	IBA	biological process
GO:0010575	positive regulation of vascular endothelial growth factor production	IBA	biological process
GO:0009986	cell surface	IBA	cellular component
GO:0008449	N-acetylglucosamine-6-sulfatase activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0005539	glycosaminoglycan binding	IBA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0003824	catalytic activity	IEA	molecular function
GO:0008484	sulfuric ester hydrolase activity	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0001822	kidney development	IEA	biological process
GO:0002063	chondrocyte development	IEA	biological process
GO:0003094	glomerular filtration	IEA	biological process
GO:0009611	response to wounding	IEA	biological process
GO:0030201	heparan sulfate proteoglycan metabolic process	IEA	biological process
GO:0048706	embryonic skeletal system development	IEA	biological process
GO:0051216	cartilage development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0008449	N-acetylglucosamine-6-sulfatase activity	IEA	molecular function
GO:0010575	positive regulation of vascular endothelial growth factor production	IEA	biological process
GO:0014846	esophagus smooth muscle contraction	IEA	biological process
GO:0032836	glomerular basement membrane development	IEA	biological process
GO:0035860	glial cell-derived neurotrophic factor receptor signaling pathway	IEA	biological process
GO:0040037	negative regulation of fibroblast growth factor receptor signaling pathway	IEA	biological process
GO:0060348	bone development	IEA	biological process
GO:0060384	innervation	IEA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0097421	liver regeneration	IEA	biological process
GO:2000345	regulation of hepatocyte proliferation	IEA	biological process
GO:0001822	kidney development	ISS	biological process
GO:0040037	negative regulation of fibroblast growth factor receptor signaling pathway	ISS	biological process
GO:0060348	bone development	ISS	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0005795	Golgi stack	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0008449	N-acetylglucosamine-6-sulfatase activity	IDA	molecular function
GO:0004065	arylsulfatase activity	IDA	molecular function
GO:0030201	heparan sulfate proteoglycan metabolic process	IDA	biological process
GO:0030177	positive regulation of Wnt signaling pathway	IDA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0032836	glomerular basement membrane development	ISS	biological process
GO:0014846	esophagus smooth muscle contraction	ISS	biological process
GO:0008449	N-acetylglucosamine-6-sulfatase activity	IMP	molecular function
GO:0005886	plasma membrane	ISS	cellular component
GO:0004065	arylsulfatase activity	IMP	molecular function
GO:0051216	cartilage development	ISS	biological process
GO:0048706	embryonic skeletal system development	ISS	biological process
GO:0030201	heparan sulfate proteoglycan metabolic process	NAS	biological process
GO:0060384	innervation	ISS	biological process
GO:0040037	negative regulation of fibroblast growth factor receptor signaling pathway	ISS	biological process
GO:0035860	glial cell-derived neurotrophic factor receptor signaling pathway	ISS	biological process
GO:0010575	positive regulation of vascular endothelial growth factor production	ISS	biological process
GO:0005615	extracellular space	NAS	cellular component
GO:0003094	glomerular filtration	ISS	biological process
GO:0002063	chondrocyte development	ISS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq