Male Infertility Database

Search Result

Gene id

5595

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

MAPK3 Gene UCSC Ensembl

Aliases

ERK-1, ERK1, ERT2, HS44KDAP, HUMKER1A, P44ERK1, P44MAPK, PRKM3, p44-ERK1, p44-MAPK

Gene name

mitogen-activated protein kinase 3

Alternate names

mitogen-activated protein kinase 3, MAP kinase isoform p44, MAPK 1, extracellular signal-regulated kinase 1, extracellular signal-related kinase 1, insulin-stimulated MAP2 kinase, microtubule-associated protein 2 kinase,

Gene location

16p11.2 (30123308: 30114104) Exons: 10 NC_000016.10

Gene summary(Entrez)

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, a

OMIM

601795

Protein Summary

Protein general information

P27361

Name: Mitogen activated protein kinase 3 (MAP kinase 3) (MAPK 3) (EC 2.7.11.24) (ERT2) (Extracellular signal regulated kinase 1) (ERK 1) (Insulin stimulated MAP2 kinase) (MAP kinase isoform p44) (p44 MAPK) (Microtubule associated protein 2 kinase) (p44 ERK1)

Length: 379 Mass: 43,136

Tissue specificity: Detected in blood plasma (PubMed

Sequence

MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISP
FEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQI
LRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKS
IDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGV
LEAP

Structural information

Protein Domains	Protein (42-330)
Interpro:	IPR011009 IPR003527 IPR008349 IPR000719 IPR017441 IPR008271
Prosite:	PS01351 PS00107 PS50011 PS00108
PDB:	2ZOQ 4QTB
PDBsum:	2ZOQ 4QTB
DIP:	30985
MINT:
STRING:	ENSP00000263025

Other Databases

GeneCards: MAPK3 Malacards: MAPK3

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	NAS	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0000187	activation of MAPK activi ty	TAS	biological process
GO:0000189	MAPK import into nucleus	IEA	biological process
GO:0001784	phosphotyrosine binding	IEA	molecular function
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological process
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	NAS	molecular function
GO:0004707	MAP kinase activity	IDA	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0005769	early endosome	TAS	cellular component
GO:0005770	late endosome	TAS	cellular component
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005901	caveola	TAS	cellular component
GO:0005925	focal adhesion	TAS	cellular component
GO:0006361	transcription initiation from RNA polymerase I pro moter	TAS	biological process
GO:0006461	protein complex assembly	IEA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006975	DNA damage induced protei n phosphorylation	IDA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0007411	axon guidance	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological process
GO:0009636	response to toxic substan ce	IEA	biological process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016310	phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphory lation	IEA	biological process
GO:0019233	sensory perception of pai n	IEA	biological process
GO:0019369	arachidonic acid metaboli c process	IEA	biological process
GO:0019902	phosphatase binding	IPI	molecular function
GO:0030168	platelet activation	TAS	biological process
GO:0030509	BMP signaling pathway	IMP	biological process
GO:0030878	thyroid gland development	IEA	biological process
GO:0031143	pseudopodium	IEA	cellular component
GO:0031281	positive regulation of cy clase activity	IMP	biological process
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IEA	biological process
GO:0032212	positive regulation of te lomere maintenance via te lomerase	IMP	biological process
GO:0032872	regulation of stress-acti vated MAPK cascade	TAS	biological process
GO:0033129	positive regulation of hi stone phosphorylation	IMP	biological process
GO:0035066	positive regulation of hi stone acetylation	IMP	biological process
GO:0038083	peptidyl-tyrosine autopho sphorylation	IDA	biological process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological process
GO:0042473	outer ear morphogenesis	IEA	biological process
GO:0043234	protein complex	IEA	cellular component
GO:0043330	response to exogenous dsR NA	IEA	biological process
GO:0045727	positive regulation of tr anslation	IEA	biological process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological process
GO:0048538	thymus development	IEA	biological process
GO:0051090	regulation of sequence-sp ecific DNA binding transc ription factor activity	TAS	biological process
GO:0051216	cartilage development	IEA	biological process
GO:0051493	regulation of cytoskeleto n organization	TAS	biological process
GO:0051973	positive regulation of te lomerase activity	IMP	biological process
GO:0060020	Bergmann glial cell diffe rentiation	IEA	biological process
GO:0060324	face development	IEA	biological process
GO:0060397	JAK-STAT cascade involved in growth hormone signal ing pathway	TAS	biological process
GO:0060425	lung morphogenesis	IEA	biological process
GO:0060440	trachea formation	IEA	biological process
GO:0061308	cardiac neural crest cell development involved in heart development	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070371	ERK1 and ERK2 cascade	IEA	biological process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological process
GO:0070498	interleukin-1-mediated si gnaling pathway	IMP	biological process
GO:0070849	response to epidermal gro wth factor	IDA	biological process
GO:0070849	response to epidermal gro wth factor	IDA	biological process
GO:0071260	cellular response to mech anical stimulus	IEP	biological process
GO:0072584	caveolin-mediated endocyt osis	TAS	biological process
GO:0090170	regulation of Golgi inher itance	TAS	biological process
GO:0097110	scaffold protein binding	IEA	molecular function
GO:1900034	regulation of cellular re sponse to heat	TAS	biological process
GO:1904355	positive regulation of te lomere capping	IMP	biological process
GO:1904417	positive regulation of xe nophagy	IEA	biological process
GO:2000641	regulation of early endos ome to late endosome tran sport	TAS	biological process
GO:2000657	negative regulation of ap olipoprotein binding	IEA	biological process
GO:0000165	MAPK cascade	IEA	biological process
GO:0000165	MAPK cascade	NAS	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000187	activation of MAPK activi ty	TAS	biological process
GO:0000189	MAPK import into nucleus	IEA	biological process
GO:0001784	phosphotyrosine binding	IEA	molecular function
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0004707	MAP kinase activity	NAS	molecular function
GO:0004707	MAP kinase activity	IDA	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0005769	early endosome	TAS	cellular component
GO:0005770	late endosome	TAS	cellular component
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005901	caveola	TAS	cellular component
GO:0005925	focal adhesion	TAS	cellular component
GO:0006351	transcription, DNA-templa ted	IEA	biological process
GO:0006361	transcription initiation from RNA polymerase I pro moter	TAS	biological process
GO:0006461	protein complex assembly	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006975	DNA damage induced protei n phosphorylation	IDA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0007411	axon guidance	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological process
GO:0009636	response to toxic substan ce	IEA	biological process
GO:0009887	animal organ morphogenesi s	IEA	biological process
GO:0014032	neural crest cell develop ment	IEA	biological process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016310	phosphorylation	IDA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0018105	peptidyl-serine phosphory lation	IEA	biological process
GO:0019233	sensory perception of pai n	IEA	biological process
GO:0019369	arachidonic acid metaboli c process	IEA	biological process
GO:0019902	phosphatase binding	IPI	molecular function
GO:0030168	platelet activation	TAS	biological process
GO:0030509	BMP signaling pathway	IMP	biological process
GO:0030878	thyroid gland development	IEA	biological process
GO:0031143	pseudopodium	IEA	cellular component
GO:0031281	positive regulation of cy clase activity	IMP	biological process
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IEA	biological process
GO:0032212	positive regulation of te lomere maintenance via te lomerase	IMP	biological process
GO:0032496	response to lipopolysacch aride	IEA	biological process
GO:0032872	regulation of stress-acti vated MAPK cascade	TAS	biological process
GO:0033129	positive regulation of hi stone phosphorylation	IMP	biological process
GO:0035066	positive regulation of hi stone acetylation	IMP	biological process
GO:0035556	intracellular signal tran sduction	IEA	biological process
GO:0038083	peptidyl-tyrosine autopho sphorylation	IDA	biological process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological process
GO:0042473	outer ear morphogenesis	IEA	biological process
GO:0043234	protein complex	IEA	cellular component
GO:0043330	response to exogenous dsR NA	IEA	biological process
GO:0045727	positive regulation of tr anslation	IEA	biological process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological process
GO:0048538	thymus development	IEA	biological process
GO:0051090	regulation of sequence-sp ecific DNA binding transc ription factor activity	IEA	biological process
GO:0051090	regulation of sequence-sp ecific DNA binding transc ription factor activity	TAS	biological process
GO:0051216	cartilage development	IEA	biological process
GO:0051493	regulation of cytoskeleto n organization	TAS	biological process
GO:0051973	positive regulation of te lomerase activity	IMP	biological process
GO:0060020	Bergmann glial cell diffe rentiation	IEA	biological process
GO:0060324	face development	IEA	biological process
GO:0060397	JAK-STAT cascade involved in growth hormone signal ing pathway	TAS	biological process
GO:0060425	lung morphogenesis	IEA	biological process
GO:0060440	trachea formation	IEA	biological process
GO:0061308	cardiac neural crest cell development involved in heart development	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070371	ERK1 and ERK2 cascade	IEA	biological process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological process
GO:0070498	interleukin-1-mediated si gnaling pathway	IMP	biological process
GO:0070849	response to epidermal gro wth factor	IDA	biological process
GO:0070849	response to epidermal gro wth factor	IDA	biological process
GO:0071260	cellular response to mech anical stimulus	IEP	biological process
GO:0072584	caveolin-mediated endocyt osis	TAS	biological process
GO:0090170	regulation of Golgi inher itance	TAS	biological process
GO:0097110	scaffold protein binding	IEA	molecular function
GO:1900034	regulation of cellular re sponse to heat	TAS	biological process
GO:1904355	positive regulation of te lomere capping	IMP	biological process
GO:1904417	positive regulation of xe nophagy	IEA	biological process
GO:2000641	regulation of early endos ome to late endosome tran sport	TAS	biological process
GO:2000657	negative regulation of ap olipoprotein binding	IEA	biological process
GO:0000165	MAPK cascade	NAS	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0000187	activation of MAPK activi ty	TAS	biological process
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological process
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	NAS	molecular function
GO:0004707	MAP kinase activity	IDA	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0005769	early endosome	TAS	cellular component
GO:0005770	late endosome	TAS	cellular component
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005901	caveola	TAS	cellular component
GO:0005925	focal adhesion	TAS	cellular component
GO:0006361	transcription initiation from RNA polymerase I pro moter	TAS	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006975	DNA damage induced protei n phosphorylation	IDA	biological process
GO:0007411	axon guidance	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathwa y	TAS	biological process
GO:0014066	regulation of phosphatidy linositol 3-kinase signal ing	TAS	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016310	phosphorylation	IDA	biological process
GO:0019902	phosphatase binding	IPI	molecular function
GO:0030168	platelet activation	TAS	biological process
GO:0030509	BMP signaling pathway	IMP	biological process
GO:0031281	positive regulation of cy clase activity	IMP	biological process
GO:0032212	positive regulation of te lomere maintenance via te lomerase	IMP	biological process
GO:0032872	regulation of stress-acti vated MAPK cascade	TAS	biological process
GO:0033129	positive regulation of hi stone phosphorylation	IMP	biological process
GO:0035066	positive regulation of hi stone acetylation	IMP	biological process
GO:0038083	peptidyl-tyrosine autopho sphorylation	IDA	biological process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological process
GO:0051090	regulation of sequence-sp ecific DNA binding transc ription factor activity	TAS	biological process
GO:0051493	regulation of cytoskeleto n organization	TAS	biological process
GO:0051973	positive regulation of te lomerase activity	IMP	biological process
GO:0060397	JAK-STAT cascade involved in growth hormone signal ing pathway	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological process
GO:0070498	interleukin-1-mediated si gnaling pathway	IMP	biological process
GO:0070849	response to epidermal gro wth factor	IDA	biological process
GO:0070849	response to epidermal gro wth factor	IDA	biological process
GO:0071260	cellular response to mech anical stimulus	IEP	biological process
GO:0072584	caveolin-mediated endocyt osis	TAS	biological process
GO:0090170	regulation of Golgi inher itance	TAS	biological process
GO:1900034	regulation of cellular re sponse to heat	TAS	biological process
GO:1904355	positive regulation of te lomere capping	IMP	biological process
GO:2000641	regulation of early endos ome to late endosome tran sport	TAS	biological process

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa04668	TNF signaling pathway
hsa04066	HIF-1 signaling pathway
hsa04068	FoxO signaling pathway
hsa04072	Phospholipase D signaling pathway
hsa04071	Sphingolipid signaling pathway
hsa04024	cAMP signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa04151	PI3K-Akt signaling pathway
hsa04150	mTOR signaling pathway
hsa04140	Autophagy - animal
hsa04114	Oocyte meiosis
hsa04210	Apoptosis
hsa04218	Cellular senescence
hsa04510	Focal adhesion
hsa04520	Adherens junction
hsa04540	Gap junction
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa04810	Regulation of actin cytoskeleton
hsa04611	Platelet activation
hsa04620	Toll-like receptor signaling pathway
hsa04621	NOD-like receptor signaling pathway
hsa04625	C-type lectin receptor signaling pathway
hsa04650	Natural killer cell mediated cytotoxicity
hsa04660	T cell receptor signaling pathway
hsa04658	Th1 and Th2 cell differentiation
hsa04659	Th17 cell differentiation
hsa04657	IL-17 signaling pathway
hsa04662	B cell receptor signaling pathway
hsa04664	Fc epsilon RI signaling pathway
hsa04666	Fc gamma R-mediated phagocytosis
hsa04062	Chemokine signaling pathway
hsa04910	Insulin signaling pathway
hsa04929	GnRH secretion
hsa04912	GnRH signaling pathway
hsa04915	Estrogen signaling pathway
hsa04914	Progesterone-mediated oocyte maturation
hsa04917	Prolactin signaling pathway
hsa04921	Oxytocin signaling pathway
hsa04926	Relaxin signaling pathway
hsa04919	Thyroid hormone signaling pathway
hsa04928	Parathyroid hormone synthesis, secretion and action
hsa04916	Melanogenesis
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04270	Vascular smooth muscle contraction
hsa04960	Aldosterone-regulated sodium reabsorption
hsa04724	Glutamatergic synapse
hsa04725	Cholinergic synapse
hsa04726	Serotonergic synapse
hsa04720	Long-term potentiation
hsa04730	Long-term depression
hsa04723	Retrograde endocannabinoid signaling
hsa04722	Neurotrophin signaling pathway
hsa04360	Axon guidance
hsa04380	Osteoclast differentiation
hsa04713	Circadian entrainment
hsa05200	Pathways in cancer
hsa05206	MicroRNAs in cancer
hsa05205	Proteoglycans in cancer
hsa05203	Viral carcinogenesis
hsa05230	Central carbon metabolism in cancer
hsa05231	Choline metabolism in cancer
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05210	Colorectal cancer
hsa05212	Pancreatic cancer
hsa05225	Hepatocellular carcinoma
hsa05226	Gastric cancer
hsa05214	Glioma
hsa05216	Thyroid cancer
hsa05221	Acute myeloid leukemia
hsa05220	Chronic myeloid leukemia
hsa05218	Melanoma
hsa05211	Renal cell carcinoma
hsa05219	Bladder cancer
hsa05215	Prostate cancer
hsa05213	Endometrial cancer
hsa05224	Breast cancer
hsa05223	Non-small cell lung cancer
hsa05010	Alzheimer disease
hsa05020	Prion diseases
hsa05034	Alcoholism
hsa04930	Type II diabetes mellitus
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa04934	Cushing syndrome
hsa05130	Pathogenic Escherichia coli infection
hsa05132	Salmonella infection
hsa05131	Shigellosis
hsa05135	Yersinia infection
hsa05133	Pertussis
hsa05152	Tuberculosis
hsa05166	Human T-cell leukemia virus 1 infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05164	Influenza A
hsa05161	Hepatitis B
hsa05160	Hepatitis C
hsa05163	Human cytomegalovirus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05165	Human papillomavirus infection
hsa05145	Toxoplasmosis
hsa05140	Leishmaniasis
hsa05142	Chagas disease
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa01524	Platinum drug resistance
hsa01522	Endocrine resistance

Diseases

Expand All | Collapse All

Associated diseases	References
Bone diseases	GAD: 19453261
Autism	GAD: 19242545
Autism	GAD: 19242545
Varicocele	MIK: 26209830
Can predict poor sperm quality	MIK: 18372245
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Varicocele	MIK: 26209830

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
26209830	Varicocele	37	Male infertility		Show abstract
18372245	Can predic t poor spe rm quality		Male infertility		Show abstract
17327269	Teratozoos permia	13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
28606200	Cryptorchi dism	Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All