• Gene id: 5594

Gene Summary

• Gene Symbol: MAPK1   Gene   UCSC   Ensembl
• Aliases: ERK, ERK-2, ERK2, ERT1, MAPK2, P42MAPK, PRKM1, PRKM2, p38, p40, p41, p41mapk, p42-MAPK
• Gene name: mitogen-activated protein kinase 1
• Alternate names: mitogen-activated protein kinase 1, MAP kinase 1, MAP kinase 2, MAP kinase isoform p42, MAPK 2, extracellular signal-regulated kinase 2, mitogen-activated protein kinase 2, protein tyrosine kinase ERK2,
• Gene location: 22q11.22 (21867679: 21759656)     Exons: 9     NC_000022.11
• Gene summary(Entrez): This gene encodes a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as p
• OMIM: 176948

Protein Summary

• Protein general information: P28482  
  • Name: Mitogen activated protein kinase 1 (MAP kinase 1) (MAPK 1) (EC 2.7.11.24) (ERT1) (Extracellular signal regulated kinase 2) (ERK 2) (MAP kinase isoform p42) (p42 MAPK) (Mitogen activated protein kinase 2) (MAP kinase 2) (MAPK 2)
  • Length: 360  
  • Mass: 41,390
• Sequence:

  MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKIL
  LRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDL
  KPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNR
  PIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
  RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

• Structural information:
  • Protein Domains: Protein (25-313)
  • Interpro: IPR011009  IPR003527  IPR008349  IPR000719  IPR017441   IPR008271  
  • Prosite: PS01351 PS00107 PS50011 PS00108
  • PDB: 1PME 1TVO 1WZY 2OJG 2OJI 2OJJ 2Y9Q 3D42 3D44 3I5Z 3I60 3SA0 3TEI 3W55 4FMQ 4FUX 4FUY 4FV0 4FV1 4FV2 4FV3 4FV4 4FV5 4FV6 4FV7 4FV8 4FV9 4G6N 4G6O 4H3P 4H3Q 4IZ5 4IZ7 4IZA 4N0S 4NIF 4O6E 4QP1 4QP2 4QP3 4QP4 4QP6 4QP7 4QP8 4QP9 4QPA 4QTA 4QTE 4XJ0 4ZXT 4ZZM
  • PDBsum: 1PME 1TVO 1WZY 2OJG 2OJI 2OJJ 2Y9Q 3D42 3D44 3I5Z 3I60 3SA0 3TEI 3W55 4FMQ 4FUX 4FUY 4FV0 4FV1 4FV2 4FV3 4FV4 4FV5 4FV6 4FV7 4FV8 4FV9 4G6N 4G6O 4H3P 4H3Q 4IZ5 4IZ7 4IZA 4N0S 4NIF 4O6E 4QP1 4QP2 4QP3 4QP4 4QP6 4QP7 4QP8 4QP9 4QPA 4QTA 4QTE 4XJ0 4ZXT 4ZZM
  • DIP: 519
  • STRING: ENSP00000215832
• Other Databases: GeneCards:  MAPK1  Malacards:  MAPK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	TAS	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0000189	MAPK import into nucleus	IEA	biological process
GO:0001784	phosphotyrosine binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0005769	early endosome	TAS	cellular component
GO:0005770	late endosome	TAS	cellular component
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005901	caveola	TAS	cellular component
GO:0005925	focal adhesion	TAS	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0006950	response to stress	TAS	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0007411	axon guidance	TAS	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0008353	RNA polymerase II carboxy-terminal domain kinase activity	ISS	molecular function
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0010800	positive regulation of peptidyl-threonine phosphorylation	IDA	biological process
GO:0014066	regulation of phosphatidylinositol 3-kinase signaling	TAS	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018107	peptidyl-threonine phosphorylation	ISS	biological process
GO:0019233	sensory perception of pain	IEA	biological process
GO:0019858	cytosine metabolic process	IEA	biological process
GO:0019902	phosphatase binding	IPI	molecular function
GO:0030168	platelet activation	TAS	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0030878	thyroid gland development	IEA	biological process
GO:0031143	pseudopodium	IEA	cellular component
GO:0031435	mitogen-activated protein kinase kinase kinase binding	IEA	molecular function
GO:0031647	regulation of protein stability	ISS	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IEA	biological process
GO:0032212	positive regulation of telomere maintenance via telomerase	IMP	biological process
GO:0032839	dendrite cytoplasm	IEA	cellular component
GO:0032872	regulation of stress-activated MAPK cascade	TAS	biological process
GO:0033598	mammary gland epithelial cell proliferation	IEA	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0038127	ERBB signaling pathway	IDA	biological process
GO:0042473	outer ear morphogenesis	IEA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0043204	perikaryon	IEA	cellular component
GO:0043234	protein complex	IEA	cellular component
GO:0043330	response to exogenous dsRNA	IEA	biological process
GO:0043627	response to estrogen	IEA	biological process
GO:0045596	negative regulation of cell differentiation	IEA	biological process
GO:0045727	positive regulation of translation	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0048538	thymus development	IEA	biological process
GO:0050852	T cell receptor signaling pathway	IEA	biological process
GO:0050853	B cell receptor signaling pathway	IEA	biological process
GO:0051090	regulation of sequence-specific DNA binding transcription factor activity	TAS	biological process
GO:0051493	regulation of cytoskeleton organization	TAS	biological process
GO:0051973	positive regulation of telomerase activity	IMP	biological process
GO:0060020	Bergmann glial cell differentiation	IEA	biological process
GO:0060291	long-term synaptic potentiation	IEA	biological process
GO:0060324	face development	IEA	biological process
GO:0060397	JAK-STAT cascade involved in growth hormone signaling pathway	TAS	biological process
GO:0060425	lung morphogenesis	IEA	biological process
GO:0060440	trachea formation	IEA	biological process
GO:0060716	labyrinthine layer blood vessel development	IEA	biological process
GO:0061308	cardiac neural crest cell development involved in heart development	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070371	ERK1 and ERK2 cascade	IDA	biological process
GO:0070371	ERK1 and ERK2 cascade	TAS	biological process
GO:0070849	response to epidermal growth factor	IDA	biological process
GO:0072584	caveolin-mediated endocytosis	TAS	biological process
GO:0072686	mitotic spindle	ISS	cellular component
GO:0090170	regulation of Golgi inheritance	TAS	biological process
GO:0097011	cellular response to granulocyte macrophage colony-stimulating factor stimulus	IEA	biological process
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:1904355	positive regulation of telomere capping	IMP	biological process
GO:2000641	regulation of early endosome to late endosome transport	TAS	biological process
GO:0000165	MAPK cascade	IEA	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0000189	MAPK import into nucleus	IEA	biological process
GO:0001784	phosphotyrosine binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0005769	early endosome	TAS	cellular component
GO:0005770	late endosome	TAS	cellular component
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005901	caveola	TAS	cellular component
GO:0005925	focal adhesion	TAS	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0006950	response to stress	TAS	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0007411	axon guidance	TAS	biological process
GO:0007507	heart development	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0008353	RNA polymerase II carboxy-terminal domain kinase activity	IEA	molecular function
GO:0008353	RNA polymerase II carboxy-terminal domain kinase activity	ISS	molecular function
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0009887	animal organ morphogenesis	IEA	biological process
GO:0010800	positive regulation of peptidyl-threonine phosphorylation	IDA	biological process
GO:0014032	neural crest cell development	IEA	biological process
GO:0014066	regulation of phosphatidylinositol 3-kinase signaling	TAS	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IEA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IEA	biological process
GO:0018107	peptidyl-threonine phosphorylation	ISS	biological process
GO:0019233	sensory perception of pain	IEA	biological process
GO:0019858	cytosine metabolic process	IEA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0019902	phosphatase binding	IPI	molecular function
GO:0030168	platelet activation	TAS	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0030878	thyroid gland development	IEA	biological process
GO:0031143	pseudopodium	IEA	cellular component
GO:0031435	mitogen-activated protein kinase kinase kinase binding	IEA	molecular function
GO:0031647	regulation of protein stability	ISS	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IEA	biological process
GO:0032212	positive regulation of telomere maintenance via telomerase	IMP	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0032839	dendrite cytoplasm	IEA	cellular component
GO:0032872	regulation of stress-activated MAPK cascade	TAS	biological process
GO:0033598	mammary gland epithelial cell proliferation	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0038127	ERBB signaling pathway	IDA	biological process
GO:0042473	outer ear morphogenesis	IEA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0043204	perikaryon	IEA	cellular component
GO:0043234	protein complex	IEA	cellular component
GO:0043330	response to exogenous dsRNA	IEA	biological process
GO:0043627	response to estrogen	IEA	biological process
GO:0045596	negative regulation of cell differentiation	IEA	biological process
GO:0045727	positive regulation of translation	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0048538	thymus development	IEA	biological process
GO:0050852	T cell receptor signaling pathway	IEA	biological process
GO:0050853	B cell receptor signaling pathway	IEA	biological process
GO:0051090	regulation of sequence-specific DNA binding transcription factor activity	TAS	biological process
GO:0051493	regulation of cytoskeleton organization	TAS	biological process
GO:0051973	positive regulation of telomerase activity	IMP	biological process
GO:0060020	Bergmann glial cell differentiation	IEA	biological process
GO:0060291	long-term synaptic potentiation	IEA	biological process
GO:0060324	face development	IEA	biological process
GO:0060397	JAK-STAT cascade involved in growth hormone signaling pathway	TAS	biological process
GO:0060425	lung morphogenesis	IEA	biological process
GO:0060440	trachea formation	IEA	biological process
GO:0060716	labyrinthine layer blood vessel development	IEA	biological process
GO:0061308	cardiac neural crest cell development involved in heart development	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070371	ERK1 and ERK2 cascade	IEA	biological process
GO:0070371	ERK1 and ERK2 cascade	IDA	biological process
GO:0070371	ERK1 and ERK2 cascade	TAS	biological process
GO:0070849	response to epidermal growth factor	IDA	biological process
GO:0071310	cellular response to organic substance	IEA	biological process
GO:0072584	caveolin-mediated endocytosis	TAS	biological process
GO:0072686	mitotic spindle	ISS	cellular component
GO:0090170	regulation of Golgi inheritance	TAS	biological process
GO:0097011	cellular response to granulocyte macrophage colony-stimulating factor stimulus	IEA	biological process
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:1904355	positive regulation of telomere capping	IMP	biological process
GO:2000641	regulation of early endosome to late endosome transport	TAS	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0005769	early endosome	TAS	cellular component
GO:0005770	late endosome	TAS	cellular component
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005901	caveola	TAS	cellular component
GO:0005925	focal adhesion	TAS	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0006950	response to stress	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0007411	axon guidance	TAS	biological process
GO:0008353	RNA polymerase II carboxy-terminal domain kinase activity	ISS	molecular function
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0010800	positive regulation of peptidyl-threonine phosphorylation	IDA	biological process
GO:0014066	regulation of phosphatidylinositol 3-kinase signaling	TAS	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018107	peptidyl-threonine phosphorylation	ISS	biological process
GO:0019902	phosphatase binding	IPI	molecular function
GO:0030168	platelet activation	TAS	biological process
GO:0031647	regulation of protein stability	ISS	biological process
GO:0032212	positive regulation of telomere maintenance via telomerase	IMP	biological process
GO:0032872	regulation of stress-activated MAPK cascade	TAS	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0038127	ERBB signaling pathway	IDA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0051090	regulation of sequence-specific DNA binding transcription factor activity	TAS	biological process
GO:0051493	regulation of cytoskeleton organization	TAS	biological process
GO:0051973	positive regulation of telomerase activity	IMP	biological process
GO:0060397	JAK-STAT cascade involved in growth hormone signaling pathway	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070371	ERK1 and ERK2 cascade	IDA	biological process
GO:0070371	ERK1 and ERK2 cascade	TAS	biological process
GO:0070849	response to epidermal growth factor	IDA	biological process
GO:0072584	caveolin-mediated endocytosis	TAS	biological process
GO:0072686	mitotic spindle	ISS	cellular component
GO:0090170	regulation of Golgi inheritance	TAS	biological process
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:1904355	positive regulation of telomere capping	IMP	biological process
GO:2000641	regulation of early endosome to late endosome transport	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04668	TNF signaling pathway
hsa04066	HIF-1 signaling pathway
hsa04068	FoxO signaling pathway
hsa04072	Phospholipase D signaling pathway
hsa04071	Sphingolipid signaling pathway
hsa04024	cAMP signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa04151	PI3K-Akt signaling pathway
hsa04150	mTOR signaling pathway
hsa04140	Autophagy - animal
hsa04114	Oocyte meiosis
hsa04210	Apoptosis
hsa04218	Cellular senescence
hsa04510	Focal adhesion
hsa04520	Adherens junction
hsa04540	Gap junction
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa04810	Regulation of actin cytoskeleton
hsa04611	Platelet activation
hsa04620	Toll-like receptor signaling pathway
hsa04621	NOD-like receptor signaling pathway
hsa04625	C-type lectin receptor signaling pathway
hsa04650	Natural killer cell mediated cytotoxicity
hsa04660	T cell receptor signaling pathway
hsa04658	Th1 and Th2 cell differentiation
hsa04659	Th17 cell differentiation
hsa04657	IL-17 signaling pathway
hsa04662	B cell receptor signaling pathway
hsa04664	Fc epsilon RI signaling pathway
hsa04666	Fc gamma R-mediated phagocytosis
hsa04062	Chemokine signaling pathway
hsa04910	Insulin signaling pathway
hsa04929	GnRH secretion
hsa04912	GnRH signaling pathway
hsa04915	Estrogen signaling pathway
hsa04914	Progesterone-mediated oocyte maturation
hsa04917	Prolactin signaling pathway
hsa04921	Oxytocin signaling pathway
hsa04926	Relaxin signaling pathway
hsa04919	Thyroid hormone signaling pathway
hsa04928	Parathyroid hormone synthesis, secretion and action
hsa04916	Melanogenesis
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04270	Vascular smooth muscle contraction
hsa04960	Aldosterone-regulated sodium reabsorption
hsa04724	Glutamatergic synapse
hsa04725	Cholinergic synapse
hsa04726	Serotonergic synapse
hsa04720	Long-term potentiation
hsa04730	Long-term depression
hsa04723	Retrograde endocannabinoid signaling
hsa04722	Neurotrophin signaling pathway
hsa04360	Axon guidance
hsa04380	Osteoclast differentiation
hsa04713	Circadian entrainment
hsa05200	Pathways in cancer
hsa05206	MicroRNAs in cancer
hsa05205	Proteoglycans in cancer
hsa05203	Viral carcinogenesis
hsa05230	Central carbon metabolism in cancer
hsa05231	Choline metabolism in cancer
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05210	Colorectal cancer
hsa05212	Pancreatic cancer
hsa05225	Hepatocellular carcinoma
hsa05226	Gastric cancer
hsa05214	Glioma
hsa05216	Thyroid cancer
hsa05221	Acute myeloid leukemia
hsa05220	Chronic myeloid leukemia
hsa05218	Melanoma
hsa05211	Renal cell carcinoma
hsa05219	Bladder cancer
hsa05215	Prostate cancer
hsa05213	Endometrial cancer
hsa05224	Breast cancer
hsa05223	Non-small cell lung cancer
hsa05010	Alzheimer disease
hsa05020	Prion diseases
hsa05034	Alcoholism
hsa04930	Type II diabetes mellitus
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa04934	Cushing syndrome
hsa05130	Pathogenic Escherichia coli infection
hsa05132	Salmonella infection
hsa05131	Shigellosis
hsa05135	Yersinia infection
hsa05133	Pertussis
hsa05152	Tuberculosis
hsa05166	Human T-cell leukemia virus 1 infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05164	Influenza A
hsa05161	Hepatitis B
hsa05160	Hepatitis C
hsa05163	Human cytomegalovirus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05165	Human papillomavirus infection
hsa05145	Toxoplasmosis
hsa05140	Leishmaniasis
hsa05142	Chagas disease
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa01524	Platinum drug resistance
hsa01522	Endocrine resistance

Diseases

Associated diseases	References
Cancer	GAD: 19730683
Cancer (ovarian)	GAD: 20628624
Cancer (thyroid)	GAD: 19730683
Cancer (breast)	GAD: 20508983
Multiple sclerosis	GAD: 21833088
Multiple sclerosis	GAD: 21833088
Endometriosis	INFBASE: 25996258
Female infertility	INFBASE: 25996258
Varicocele	MIK: 26209830
Semen quality	MIK: 26209830
Sperm motility	MIK: 26209830
Sperm motility	MIK: 26209830
Male factor infertility	MIK: 21961242
Spermatogenesis defects	MIK: 26209830
Asthenozoospermia	MIK: 21961242
Endometriosis	INFBASE: 9506747
Bulimia	GAD: 20468064
Chronic renal failure	GAD: 21085059
Asthenospermia	MIK: 21961242
Cryptorchidism	MIK: 28606200
Semen quality	MIK: 26209830
Sperm motility	MIK: 26209830
Teratozoospermia	MIK: 17327269
Varicocele	MIK: 26209830
Spermatogenetic defects	MIK: 26209830

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26209830	Varicocele			37	Male infertility
26209830	Semen quality, Sperm motility			37 men provided semen samples for routine analysis	Male infertility	Bad GSK-3 HSP27 JNK/SAPK mTOR p38 MAPK p53PARP Caspase-3 Akt Stat1 and p70 S6 kinase
26209830	Sperm motility			37 men provided semen samples for routine analysis	Male infertility	Bad GSK-3 HSP27 JNK/SAPK mTOR  p38 MAPK p53 PARP Caspase-3
21961242	Asthenospermia			40 (20 healthy volunteers, 20 infertile males with asthenospermia)	Male infertility	ERK
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq