• Gene id: 55929

Gene Summary

• Gene Symbol: DMAP1   Gene   UCSC   Ensembl
• Aliases: DNMAP1, DNMTAP1, EAF2, MEAF2, SWC4
• Gene name: DNA methyltransferase 1 associated protein 1
• Alternate names: DNA methyltransferase 1-associated protein 1, DNMT1 associated protein 1,
• Gene location: 1p34.1 (37891083: 38139174)     Exons: 31     NC_000004.12
• Gene summary(Entrez): This gene encodes a subunit of several, distinct complexes involved in the repression or activation of transcription. The encoded protein can independently repress transcription and is targeted to replication foci throughout S phase by interacting directl
• OMIM: 605077

Protein Summary

• Protein general information: Q9NPF5  
  • Name: DNA methyltransferase 1 associated protein 1 (DNMAP1) (DNMT1 associated protein 1)
  • Length: 467  
  • Mass: 52993
• Sequence:

  MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRPEGMHREVYALLYSDKKDAPPLLPSD
  TGQGYRTVKAKLGSKKVRPWKWMPFTNPARKDGAMFFHWRRAAEEGKDYPFARFNKTVQVPVYSEQEYQLYLHDD
  AWTKAETDHLFDLSRRFDLRFVVIHDRYDHQQFKKRSVEDLKERYYHICAKLANVRAVPGTDLKIPVFDAGHERR
  RKEQLERLYNRTPEQVAEEEYLLQELRKIEARKKEREKRSQDLQKLITAADTTAEQRRTERKAPKKKLPQKKEAE
  KPAVPETAGIKFPDFKSAGVTLRSQRMKLPSSVGQKKIKALEQMLLELGVELSPTPTEELVHMFNELRSDLVLLY
  ELKQACANCEYELQMLRHRHEALARAGVLGGPATPASGPGPASAEPAVTEPGLGPDPKDTIIDVVGAPLTPNSRK
  RRESASSSSSVKKAKKP

• Structural information:
  • Protein Domains: (149..19-)
    (/note="SANT"-)
  • Interpro: IPR032563  IPR008468  IPR027109  
  • PDB: 3HM5 4IEJ
  • PDBsum: 3HM5 4IEJ
  • STRING: ENSP00000361363
• Other Databases: GeneCards:  DMAP1  Malacards:  DMAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035267	NuA4 histone acetyltransferase complex	IBA	cellular component
GO:0043968	histone H2A acetylation	IBA	biological process
GO:0043967	histone H4 acetylation	IBA	biological process
GO:0043486	histone exchange	IBA	biological process
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0000812	Swr1 complex	IBA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0042307	positive regulation of protein import into nucleus	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0001103	RNA polymerase II repressing transcription factor binding	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0035267	NuA4 histone acetyltransferase complex	IEA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006338	chromatin remodeling	IEA	biological process
GO:0043967	histone H4 acetylation	IEA	biological process
GO:0043968	histone H2A acetylation	IEA	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045471	response to ethanol	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0005657	replication fork	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043968	histone H2A acetylation	IDA	biological process
GO:0035267	NuA4 histone acetyltransferase complex	IDA	cellular component
GO:0043967	histone H4 acetylation	IDA	biological process
GO:0005634	nucleus	NAS	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	NAS	biological process
GO:0006306	DNA methylation	TAS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq