• Gene id: 55924

Gene Summary

• Gene Symbol: INKA2   Gene   UCSC   Ensembl
• Aliases: C1orf183, FAM212B
• Gene name: inka box actin regulator 2
• Alternate names: PAK4-inhibitor INKA2, HInca-r, family with sequence similarity 212 member B, induced in neural crest by AP2-alpha protein-related homolog, protein FAM212B,
• Gene location: 1p13.2 (34363272: 34511772)     Exons: 31     NC_000020.11

Protein Summary

• Protein general information: Q9NTI7  
  • Name: PAK4 inhibitor INKA2 (Induced in neural crest by AP2 alpha protein related homolog) (HInca r) (Inka box actin regulator 2)
  • Length: 297  
  • Mass: 32759
• Sequence:

  MTMESREMDCYLRRLKQELMSMKEVGDGLQDQMNCMMGALQELKLLQVQTALEQLEISGGGPVPGSPEGPRTQCE
  HPCWEGGRGPARPTVCSPSSQPSLGSSTKFPSHRSVCGRDLAPLPRTQPHQSCAQQGPERVEPDDWTSTLMSRGR
  NRQPLVLGDNVFADLVGNWLDLPELEKGGEKGETGGAREPKGEKGQPQELGRRFALTANIFKKFLRSVRPDRDRL
  LKEKPGWVTPMVPESRTGRSQKVKKRSLSKGSGHFPFPGTGEHRRGENPPTSCPKALEHSPSGFDINTAVWV

• Structural information:
  • Interpro: IPR029267  IPR039201  
  • STRING: ENSP00000349805
• Other Databases: GeneCards:  INKA2  Malacards:  INKA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030291	protein serine/threonine kinase inhibitor activity	IBA	molecular function
GO:0019901	protein kinase binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0030291	protein serine/threonine kinase inhibitor activity	ISS	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0030291	protein serine/threonine kinase inhibitor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0071901	negative regulation of protein serine/threonine kinase activity	IEA	biological process
GO:0071901	negative regulation of protein serine/threonine kinase activity	IEA	biological process
GO:0071901	negative regulation of protein serine/threonine kinase activity	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)