• Gene id: 55920

Gene Summary

• Gene Symbol: RCC2   Gene   UCSC   Ensembl
• Aliases: TD-60
• Gene name: regulator of chromosome condensation 2
• Alternate names: protein RCC2, RCC1-like protein TD-60, epididymis secretory sperm binding protein, telophase disk protein of 60 kDa,
• Gene location: 1p36.13 (95790395: 95768952)     Exons: 13     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a guanine exchange factor that is active on RalA, a small GTPase. The encoded protein and RalA are both essential for proper kinetochore-microtubule function in early mitosis. This protein has been shown to be a biomark
• OMIM: 609587

Protein Summary

• Protein general information: Q9P258  
  • Name: Protein RCC2 (RCC1 like protein TD 60) (Telophase disk protein of 60 kDa)
  • Length: 522  
  • Mass: 56085
• Sequence:

  MPRKKAAAAAWEEPSSGNGTARAGPRKRGGPAGRKRERPERCSSSSGGGSSGDEDGLELDGAPGGGKRAARPATA
  GKAGGAAVVITEPEHTKERVKLEGSKCKGQLLIFGATNWDLIGRKEVPKQQAAYRNLGQNLWGPHRYGCLAGVRV
  RTVVSGSCAAHSLLITTEGKLWSWGRNEKGQLGHGDTKRVEAPRLIEGLSHEVIVSAACGRNHTLALTETGSVFA
  FGENKMGQLGLGNQTDAVPSPAQIMYNGQPITKMACGAEFSMIMDCKGNLYSFGCPEYGQLGHNSDGKFIARAQR
  IEYDCELVPRRVAIFIEKTKDGQILPVPNVVVRDVACGANHTLVLDSQKRVFSWGFGGYGRLGHAEQKDEMVPRL
  VKLFDFPGRGASQIYAGYTCSFAVSEVGGLFFWGATNTSRESTMYPKAVQDLCGWRIRSLACGKSSIIVAADEST
  ISWGPSPTFGELGYGDHKPKSSTAAQEVKTLDGIFSEQVAMGYSHSLVIARDESETEKEKIKKLPEYNPRTL

• Structural information:
  • Interpro: IPR009091  IPR000408  
  • Prosite: PS00626 PS50012
  • PDB: 5GWN
  • PDBsum: 5GWN
  • STRING: ENSP00000364585
• Other Databases: GeneCards:  RCC2  Malacards:  RCC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051301	cell division	IEA	biological process
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005874	microtubule	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0030334	regulation of cell migration	IEA	biological process
GO:0031901	early endosome membrane	IEA	cellular component
GO:0034260	negative regulation of GTPase activity	IEA	biological process
GO:0051895	negative regulation of focal adhesion assembly	IEA	biological process
GO:0090630	activation of GTPase activity	IEA	biological process
GO:1900025	negative regulation of substrate adhesion-dependent cell spreading	IEA	biological process
GO:1900027	regulation of ruffle assembly	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0010762	regulation of fibroblast migration	IEA	biological process
GO:0045184	establishment of protein localization	IEA	biological process
GO:0048365	Rac GTPase binding	IEA	molecular function
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:1990023	mitotic spindle midzone	IDA	cellular component
GO:0034506	chromosome, centromeric core domain	IDA	cellular component
GO:0048041	focal adhesion assembly	IDA	biological process
GO:0007229	integrin-mediated signaling pathway	IDA	biological process
GO:0030496	midbody	IDA	cellular component
GO:0016020	membrane	IDA	colocalizes with
GO:0005515	protein binding	IPI	molecular function
GO:1900025	negative regulation of substrate adhesion-dependent cell spreading	ISS	biological process
GO:0051895	negative regulation of focal adhesion assembly	ISS	biological process
GO:0030334	regulation of cell migration	ISS	biological process
GO:0010971	positive regulation of G2/M transition of mitotic cell cycle	IMP	biological process
GO:0008017	microtubule binding	IMP	molecular function
GO:0072356	chromosome passenger complex localization to kinetochore	IMP	biological process
GO:0048365	Rac GTPase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0051987	positive regulation of attachment of spindle microtubules to kinetochore	IMP	biological process
GO:0034260	negative regulation of GTPase activity	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0031267	small GTPase binding	IPI	molecular function
GO:0034260	negative regulation of GTPase activity	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq