• Gene id: 5592

Gene Summary

• Gene Symbol: PRKG1   Gene   UCSC   Ensembl
• Aliases: AAT8, PKG, PKG1, PRKG1B, PRKGR1B, cGK, cGK 1, cGK1, cGKI, cGKI-BETA, cGKI-alpha
• Gene name: protein kinase cGMP-dependent 1
• Alternate names: cGMP-dependent protein kinase 1, protein kinase, cGMP-dependent, regulatory, type I, beta, protein kinase, cGMP-dependent, type I,
• Gene location: 10q11.23-q21.1 (50990887: 52298349)     Exons: 23     NC_000010.11
• Gene summary(Entrez): Mammals have three different isoforms of cyclic GMP-dependent protein kinase (Ialpha, Ibeta, and II). These PRKG isoforms act as key mediators of the nitric oxide/cGMP signaling pathway and are important components of many signal transduction processes in
• OMIM: 614634

Protein Summary

• Protein general information: Q13976  
  • Name: cGMP dependent protein kinase 1 (cGK 1) (cGK1) (EC 2.7.11.12) (cGMP dependent protein kinase I) (cGKI)
  • Length: 671  
  • Mass: 76364
  • Tissue specificity: Primarily expressed in lung and placenta. {ECO
• Sequence:

  MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTRAQGISAEPQTYRSFH
  DLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEV
  TKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSL
  PEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDV
  RTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDFNIIDTLGVGGFGRVE
  LVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTIL
  RDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYV
  APEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS
  ERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF

• Structural information:
  • Protein Domains: (360..61-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (620..67-)
    (/note="AGC-kinase-C-terminal")
  • Interpro: IPR000961  IPR002374  IPR018490  IPR018488  IPR000595   IPR011009  IPR031831  IPR000719  IPR017441  IPR014710  IPR008271  IPR035014  
  • Prosite: PS51285 PS00888 PS00889 PS50042 PS00107 PS50011 PS00108
  • CDD: cd00038 cd05572
  • PDB: 1ZXA 3NMD 3OCP 3OD0 3OGJ 4KU7 4KU8 4QX5 4QXK 4R4L 4R4M 4Z07 5J48 5JAX 5JD7 5L0N 6BDL 6BG2 6C0T
  • PDBsum: 1ZXA 3NMD 3OCP 3OD0 3OGJ 4KU7 4KU8 4QX5 4QXK 4R4L 4R4M 4Z07 5J48 5JAX 5JD7 5L0N 6BDL 6BG2 6C0T
  • DIP: 41118 46288
  • STRING: ENSP00000363092
• Other Databases: GeneCards:  PRKG1  Malacards:  PRKG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005246	calcium channel regulator activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0004692	cGMP-dependent protein kinase activity	IDA	molecular function
GO:0090331	negative regulation of platelet aggregation	IMP	biological process
GO:0043087	regulation of GTPase activity	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0008152	metabolic process	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0030553	cGMP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0030036	actin cytoskeleton organization	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060087	relaxation of vascular smooth muscle	IEA	biological process
GO:0045986	negative regulation of smooth muscle contraction	IEA	biological process
GO:0019934	cGMP-mediated signaling	IEA	biological process
GO:0016358	dendrite development	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0001764	neuron migration	IEA	biological process
GO:0030900	forebrain development	IEA	biological process
GO:0030553	cGMP binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0004672	protein kinase activity	IMP	molecular function
GO:1904753	negative regulation of vascular associated smooth muscle cell migration	IDA	biological process
GO:1904706	negative regulation of vascular smooth muscle cell proliferation	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006468	protein phosphorylation	IDA	NOT|biological process

KEGG pathways

Pathway id	Pathway name
hsa04714	Thermogenesis
hsa04022	cGMP-PKG signaling pathway
hsa04740	Olfactory transduction
hsa04270	Vascular smooth muscle contraction
hsa04611	Platelet activation
hsa04713	Circadian entrainment
hsa04970	Salivary secretion
hsa04540	Gap junction
hsa04730	Long-term depression
hsa04923	Regulation of lipolysis in adipocytes
P06959	CCKR signaling map

Diseases

Associated diseases	References
Familial thoracic aortic aneurysm and dissection	KEGG:H00801
Familial thoracic aortic aneurysm and dissection	KEGG:H00801
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq