• Gene id: 55916

Gene Summary

• Gene Symbol: NXT2   Gene   UCSC   Ensembl
• Aliases: P15-2
• Gene name: nuclear transport factor 2 like export factor 2
• Alternate names: NTF2-related export protein 2, protein p15-2,
• Gene location: Xq23 (109535823: 109544697)     Exons: 7     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene contains a nuclear transport factor 2 (NTF2) domain, which plays an important role in the trafficking of macromolecules, ions, and small molecules between the cytoplasm and nucleus. This protein may also have a role in mRN
• OMIM: 300320

Protein Summary

• Protein general information: Q9NPJ8  
  • Name: NTF2 related export protein 2 (Protein p15 2)
  • Length: 142  
  • Mass: 16228
• Sequence:

  MATSLDFKTYVDQACRAAEEFVNIYYETMDKRRRALTRLYLDKATLIWNGNAVSGLDALNNFFDTLPSSEFQVNM
  LDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHFFNQNFLLTAQSTPNNTVWKIASDCFRFQDWSSS

• Structural information:
  • Protein Domains: (17..13-)
    (/note="NTF2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00137"-)
  • Interpro: IPR002075  IPR032710  IPR018222  
  • Prosite: PS50177
  • CDD: cd00780
  • STRING: ENSP00000218004
• Other Databases: GeneCards:  NXT2  Malacards:  NXT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006606	protein import into nucleus	IBA	biological process
GO:0006913	nucleocytoplasmic transport	IBA	biological process
GO:0044613	nuclear pore central transport channel	IBA	cellular component
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0051028	mRNA transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport
hsa05164	Influenza A
hsa03015	mRNA surveillance pathway
hsa03008	Ribosome biogenesis in eukaryotes

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray