• Gene id: 55915

Gene Summary

• Gene Symbol: LANCL2   Gene   UCSC   Ensembl
• Aliases: GPR69B, TASP
• Gene name: LanC like 2
• Alternate names: lanC-like protein 2, G protein-coupled receptor 69B, LanC (bacterial lantibiotic synthetase component C)-like 2, LanC lantibiotic synthetase component C-like 2, testis-specific adriamycin sensitivity protein,
• Gene location: 7p11.2 (55365447: 55433741)     Exons: 9     NC_000007.14
• OMIM: 612919

Protein Summary

• Protein general information: Q9NS86  
  • Name: LanC like protein 2 (Testis specific adriamycin sensitivity protein)
  • Length: 450  
  • Mass: 50854
  • Tissue specificity: Expressed in brain and testis. {ECO
• Sequence:

  MGETMSKRLKLHLGGEAEMEERAFVNPFPDYEAAAGALLASGAAEETGCVRPPATTDEPGLPFHQDGKIIHNFIR
  RIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKRTLRNLNGRRVTFLCG
  DAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIK
  EVVNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKK
  FRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGTAGNGY
  SFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGCRIPDRPYSLFEGMAGAIHFLSDVLGPETSRFPAFELDSSKRD

• Structural information:
  • Interpro: IPR012341  IPR007822  IPR020464  
  • CDD: cd04794
  • STRING: ENSP00000254770
• Other Databases: GeneCards:  LANCL2  Malacards:  LANCL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0070273	phosphatidylinositol-4-phosphate binding	IDA	molecular function
GO:0010314	phosphatidylinositol-5-phosphate binding	IDA	molecular function
GO:0032266	phosphatidylinositol-3-phosphate binding	IDA	molecular function
GO:0030864	cortical actin cytoskeleton	IDA	cellular component
GO:0009789	positive regulation of abscisic acid-activated signaling pathway	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0003824	catalytic activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0005524	ATP binding	NAS	molecular function
GO:0005525	GTP binding	NAS	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray