• Gene id: 55908

Gene Summary

• Gene Symbol: ANGPTL8   Gene   UCSC   Ensembl
• Aliases: C19orf80, PRO1185, PVPA599, RIFL, TD26
• Gene name: angiopoietin like 8
• Alternate names: angiopoietin-like protein 8, betatrophin variant 1, betatrophin variant 2, hepatocellular carcinoma-associated gene TD26, hepatocellular carcinoma-associated protein TD26, lipasin, refeeding-induced fat and liver protein,
• Gene location: 19p13.2 (11239618: 11241942)     Exons: 4     NC_000019.10
• OMIM: 616223

Protein Summary

• Protein general information: Q6UXH0  
  • Name: Angiopoietin like protein 8 (Betatrophin) (Lipasin) (Refeeding induced fat and liver protein)
  • Length: 198  
  • Mass: 22105
  • Tissue specificity: Predominantly expressed in liver. Also expressed in adipose tissues. {ECO
• Sequence:

  MPVPALCLLWALAMVTRPASAAPMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIE
  LLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFE
  VLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA

• Structural information:
  • Interpro: IPR026614  
  • STRING: ENSP00000479969
• Other Databases: GeneCards:  ANGPTL8  Malacards:  ANGPTL8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IBA	cellular component
GO:0019216	regulation of lipid metabolic process	IBA	biological process
GO:0070328	triglyceride homeostasis	IBA	biological process
GO:0005576	extracellular region	IDA	cellular component
GO:0070328	triglyceride homeostasis	IDA	biological process
GO:0019216	regulation of lipid metabolic process	IDA	biological process
GO:0044342	type B pancreatic cell proliferation	IDA	NOT|biological process
GO:0044255	cellular lipid metabolic process	ISS	biological process
GO:0019216	regulation of lipid metabolic process	IEA	biological process
GO:0070328	triglyceride homeostasis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0010954	positive regulation of protein processing	IDA	biological process
GO:0070328	triglyceride homeostasis	IGI	biological process
GO:0050746	regulation of lipoprotein metabolic process	IMP	biological process
GO:0051004	regulation of lipoprotein lipase activity	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0070328	triglyceride homeostasis	IEA	biological process
GO:0050746	regulation of lipoprotein metabolic process	IEA	biological process
GO:0045444	fat cell differentiation	IEA	biological process
GO:0019216	regulation of lipid metabolic process	IEA	biological process
GO:0048469	cell maturation	IEA	biological process
GO:0044255	cellular lipid metabolic process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04979	Cholesterol metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)