• Gene id: 55905

Gene Summary

• Gene Symbol: RNF114   Gene   UCSC   Ensembl
• Aliases: PSORS12, ZNF313
• Gene name: ring finger protein 114
• Alternate names: E3 ubiquitin-protein ligase RNF114, RING-type E3 ubiquitin transferase RNF114, zinc finger protein 228, zinc finger protein 313,
• Gene location: 20q13.13 (49936376: 49953884)     Exons: 6     NC_000020.11
• OMIM: 612451

Protein Summary

• Protein general information: Q9Y508  
  • Name: E3 ubiquitin protein ligase RNF114 (EC 2.3.2.27) (RING finger protein 114) (RING type E3 ubiquitin transferase RNF114) (Zinc finger protein 228) (Zinc finger protein 313)
  • Length: 228  
  • Mass: 25,694
• Sequence:

  MAAQQRDCGGAAQLAGPAAEADPLGRFTCPVCLEVYEKPVQVPCGHVFCSACLQECLKPKKPVCGVCRSALAPGV
  RAVELERQIESTETSCHGCRKNFFLSKIRSHVATCSKYQNYIMEGVKATIKDASLQPRNVPNRYTFPCPYCPEKN
  FDQEGLVEHCKLFHSTDTKSVVCPICASMPWGDPNYRSANFREHIQRRHRFSYDTFVDYDVDEEDMMNQVLQRSI
  IDQ

• Structural information:
  • Interpro: IPR008598  IPR034734  IPR027370  IPR001841  IPR013083   IPR017907  
  • Prosite: PS51803 PS00518 PS50089
  • STRING: ENSP00000244061
• Other Databases: GeneCards:  RNF114  Malacards:  RNF114

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0004842	ubiquitin-protein transferase activity	EXP	molecular function
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0005622	intracellular	IBA	cellular component
GO:0005622	intracellular	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016874	ligase activity	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0031624	ubiquitin conjugating enzyme binding	IBA	molecular function
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0004842	ubiquitin-protein transferase activity	EXP	molecular function
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0005622	intracellular	IBA	cellular component
GO:0005622	intracellular	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0016874	ligase activity	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0031624	ubiquitin conjugating enzyme binding	IBA	molecular function
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0004842	ubiquitin-protein transferase activity	EXP	molecular function
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0005622	intracellular	IBA	cellular component
GO:0005622	intracellular	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0031624	ubiquitin conjugating enzyme binding	IBA	molecular function
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function

Diseases

Associated diseases	References
Arthritis	GAD: 20953189
Psoriasis	GAD: 18364390
Parkinson disease	GAD: 17052657
Parkinson disease	GAD: 17052657
Azoospermia	MIK: 12621547
Azoospermia, Male infertility	MIK: 12621547
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
12621547	Azoospermia, Male infertility				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)