• Gene id: 5590

Gene Summary

• Gene Symbol: PRKCZ   Gene   UCSC   Ensembl
• Aliases: PKC-ZETA, PKC2
• Gene name: protein kinase C zeta
• Alternate names: protein kinase C zeta type, nPKC-zeta,
• Gene location: 1p36.33 (2050410: 2185398)     Exons: 29     NC_000001.11
• Gene summary(Entrez): Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-depende
• OMIM: 176982

Protein Summary

• Protein general information: Q05513  
  • Name: Protein kinase C zeta type (EC 2.7.11.13) (nPKC zeta)
  • Length: 592  
  • Mass: 67660
  • Tissue specificity: Expressed in brain, and to a lesser extent in lung, kidney and testis.
• Sequence:

  MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTVSSQME
  LEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGQCSER
  IWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIK
  DDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTE
  KHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYR
  DLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSP
  FDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDL
  LEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV

• Structural information:
  • Protein Domains: (15..9-)
    (/note="PB1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01081-)
    (252..51-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (519..59-)
    (/note="AGC-kinase-C-terminal")
  • Interpro: IPR000961  IPR034662  IPR020454  IPR011009  IPR034877   IPR000270  IPR002219  IPR012233  IPR017892  IPR000719  IPR017441  IPR008271  
  • Prosite: PS51285 PS51745 PS00107 PS50011 PS00108 PS00479 PS50081
  • CDD: cd00029 cd06404 cd05617
  • STRING: ENSP00000367830
• Other Databases: GeneCards:  PRKCZ  Malacards:  PRKCZ

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0005911	cell-cell junction	IDA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:2000667	positive regulation of interleukin-13 secretion	ISS	biological process
GO:2000664	positive regulation of interleukin-5 secretion	ISS	biological process
GO:2000463	positive regulation of excitatory postsynaptic potential	ISS	biological process
GO:0060291	long-term synaptic potentiation	ISS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	ISS	biological process
GO:0045630	positive regulation of T-helper 2 cell differentiation	ISS	biological process
GO:0032753	positive regulation of interleukin-4 production	ISS	biological process
GO:0030010	establishment of cell polarity	ISS	biological process
GO:2001181	positive regulation of interleukin-10 secretion	ISS	biological process
GO:2000553	positive regulation of T-helper 2 cell cytokine production	ISS	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0046628	positive regulation of insulin receptor signaling pathway	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0006954	inflammatory response	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005737	cytoplasm	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0004697	protein kinase C activity	IEA	molecular function
GO:0004698	calcium-dependent protein kinase C activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular function
GO:0007179	transforming growth factor beta receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0030054	cell junction	TAS	cellular component
GO:0030054	cell junction	TAS	cellular component
GO:0030054	cell junction	TAS	cellular component
GO:0030054	cell junction	TAS	cellular component
GO:0030054	cell junction	TAS	cellular component
GO:0030054	cell junction	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000667	positive regulation of interleukin-13 secretion	IEA	biological process
GO:2000664	positive regulation of interleukin-5 secretion	IEA	biological process
GO:0072659	protein localization to plasma membrane	IEA	biological process
GO:0045630	positive regulation of T-helper 2 cell differentiation	IEA	biological process
GO:0035748	myelin sheath abaxonal region	IEA	cellular component
GO:0032753	positive regulation of interleukin-4 production	IEA	biological process
GO:0016363	nuclear matrix	IEA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:2000463	positive regulation of excitatory postsynaptic potential	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0071889	14-3-3 protein binding	IEA	molecular function
GO:0070528	protein kinase C signaling	IEA	biological process
GO:0060291	long-term synaptic potentiation	IEA	biological process
GO:0051222	positive regulation of protein transport	IEA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0050806	positive regulation of synaptic transmission	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0047496	vesicle transport along microtubule	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0030010	establishment of cell polarity	IEA	biological process
GO:0018105	peptidyl-serine phosphorylation	IEA	biological process
GO:0016477	cell migration	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0007616	long-term memory	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0004697	protein kinase C activity	IEA	molecular function
GO:0001954	positive regulation of cell-matrix adhesion	IEA	biological process
GO:2001181	positive regulation of interleukin-10 secretion	IEA	biological process
GO:2000553	positive regulation of T-helper 2 cell cytokine production	IEA	biological process
GO:1990138	neuron projection extension	IEA	biological process
GO:0045179	apical cortex	IEA	cellular component
GO:0043203	axon hillock	IEA	cellular component
GO:0031982	vesicle	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0000226	microtubule cytoskeleton organization	IEA	biological process
GO:0098696	regulation of neurotransmitter receptor localization to postsynaptic specialization membrane	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0060081	membrane hyperpolarization	IEA	biological process
GO:0051899	membrane depolarization	IEA	biological process
GO:0051346	negative regulation of hydrolase activity	IEA	biological process
GO:0046628	positive regulation of insulin receptor signaling pathway	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0043274	phospholipase binding	IEA	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0034613	cellular protein localization	IEA	biological process
GO:0032148	activation of protein kinase B activity	IEA	biological process
GO:0031584	activation of phospholipase D activity	IEA	biological process
GO:0031252	cell leading edge	IEA	cellular component
GO:0019901	protein kinase binding	IEA	molecular function
GO:0015459	potassium channel regulator activity	IEA	molecular function
GO:0014069	postsynaptic density	IEA	cellular component
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0001725	stress fiber	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0043560	insulin receptor substrate binding	IC	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0031333	negative regulation of protein-containing complex assembly	IMP	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	IMP	biological process
GO:0050732	negative regulation of peptidyl-tyrosine phosphorylation	IMP	biological process
GO:0005768	endosome	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0004672	protein kinase activity	IDA	molecular function
GO:0006468	protein phosphorylation	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05165	Human papillomavirus infection
hsa04144	Endocytosis
hsa04015	Rap1 signaling pathway
hsa04062	Chemokine signaling pathway
hsa04360	Axon guidance
hsa04530	Tight junction
hsa04390	Hippo signaling pathway
hsa04910	Insulin signaling pathway
hsa05418	Fluid shear stress and atherosclerosis
hsa04611	Platelet activation
hsa04926	Relaxin signaling pathway
hsa04071	Sphingolipid signaling pathway
hsa04931	Insulin resistance
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa04930	Type II diabetes mellitus

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Non obstructive azoospermia, Sertoli cell only syndrome	MIK: 23869807
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R