• Gene id: 55898

Gene Summary

• Gene Symbol: UNC45A   Gene   UCSC   Ensembl
• Aliases: GC-UNC45, GCUNC-45, GCUNC45, IRO039700, SMAP-1, SMAP1, UNC-45A
• Gene name: unc-45 myosin chaperone A
• Alternate names: protein unc-45 homolog A, general cell UNC45, smooth muscle cell associated protein-1, unc-45 homolog A,
• Gene location: 15q26.1 (90930179: 90954092)     Exons: 22     NC_000015.10
• Gene summary(Entrez): This gene encodes a regulatory component of the progesterone receptor/heat shock protein 90 chaperoning complex, which functions in the assembly and folding of the progesterone receptor. The encoded protein is thought to be essential for normal cell proli
• OMIM: 610972

Protein Summary

• Protein general information: Q9H3U1  
  • Name: Protein unc 45 homolog A (Unc 45A) (GCUNC 45) (Smooth muscle cell associated protein 1) (SMAP 1)
  • Length: 944  
  • Mass: 103077
  • Tissue specificity: Detected in peripheral blood leukocytes, bone marrow, adrenal gland, trachea, spinal cord, thyroid, lymph node and stomach. {ECO
• Sequence:

  MTVSGPGTPEPRPATPGASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDATPQDQAVLHRNRAACHLKLEDYD
  KAETEASKAIEKDGGDVKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKNKVFQEALRNIGGQIQEKVRYMSSTD
  AKVEQMFQILLDPEEKGTEKKQKASQNLVVLAREDAGAEKIFRSNGVQLLQRLLDMGETDLMLAALRTLVGICSE
  HQSRTVATLSILGTRRVVSILGVESQAVSLAACHLLQVMFDALKEGVKKGFRGKEGAIIVDPARELKVLISNLLD
  LLTEVGVSGQGRDNALTLLIKAVPRKSLKDPNNSLTLWVIDQGLKKILEVGGSLQDPPGELAVTANSRMSASILL
  SKLFDDLKCDAERENFHRLCENYIKSWFEGQGLAGKLRAIQTVSCLLQGPCDAGNRALELSGVMESVIALCASEQ
  EEEQLVAVEALIHAAGKAKRASFITANGVSLLKDLYKCSEKDSIRIRALVGLCKLGSAGGTDFSMKQFAEGSTLK
  LAKQCRKWLCNDQIDAGTRRWAVEGLAYLTFDADVKEEFVEDAAALKALFQLSRLEERSVLFAVASALVNCTNSY
  DYEEPDPKMVELAKYAKQHVPEQHPKDKPSFVRARVKKLLAAGVVSAMVCMVKTESPVLTSSCRELLSRVFLALV
  EEVEDRGTVVAQGGGRALIPLALEGTDVGQTKAAQALAKLTITSNPEMTFPGERIYEVVRPLVSLLHLNCSGLQN
  FEALMALTNLAGISERLRQKILKEKAVPMIEGYMFEEHEMIRRAATECMCNLAMSKEVQDLFEAQGNDRLKLLVL
  YSGEDDELLQRAAAGGLAMLTSMRPTLCSRIPQVTTHWLEILQALLLSSNQELQHRGAVVVLNMVEASREIASTL
  MESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDGE

• Structural information:
  • Interpro: IPR011989  IPR016024  IPR013026  IPR011990  IPR019734   IPR024660  
  • Prosite: PS50005 PS50293
  • PDB: 2DBA
  • PDBsum: 2DBA
  • STRING: ENSP00000407487
• Other Databases: GeneCards:  UNC45A  Malacards:  UNC45A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061077	chaperone-mediated protein folding	IBA	biological process
GO:0051879	Hsp90 protein binding	IBA	molecular function
GO:0007517	muscle organ development	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061077	chaperone-mediated protein folding	IEA	biological process
GO:0051879	Hsp90 protein binding	IEA	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq