• Gene id: 55897

Gene Summary

• Gene Symbol: MESP1   Gene   UCSC   Ensembl
• Aliases: bHLHc5
• Gene name: mesoderm posterior bHLH transcription factor 1
• Alternate names: mesoderm posterior protein 1, class C basic helix-loop-helix protein 5, mesoderm posterior 1 homolog, mesoderm posterior basic helix-loop-helix transcription factor 1,
• Gene location: 15q26.1 (89751308: 89734771)     Exons: 7     NC_000015.10
• OMIM: 604136

Protein Summary

• Protein general information: Q9BRJ9  
  • Name: Mesoderm posterior protein 1 (Class C basic helix loop helix protein 5) (bHLHc5)
  • Length: 268  
  • Mass: 28501
• Sequence:

  MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRSLVSSPDSWGSTPADSPVASPARPGTLRDPRAPSVGRRGAR
  SSRLGSGQRQSASEREKLRMRTLARALHELRRFLPPSVAPAGQSLTKIETLRLAIRYIGHLSAVLGLSEESLQRR
  CRQRGDAGSPRGCPLCPDDCPAQMQTRTQAEGQGQGRGLGLVSAVRAGASWGSPPACPGARAAPEPRDPPALFAE
  AACPEGQAMEPSPPSPLLPGDVLALLETWMPLSPLEWLPEEPK

• Structural information:
  • Protein Domains: (82..13-)
    (/note="bHLH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00981"-)
  • Interpro: IPR011598  IPR036638  IPR040259  
  • Prosite: PS50888
  • CDD: cd00083
  • STRING: ENSP00000300057
• Other Databases: GeneCards:  MESP1  Malacards:  MESP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0032525	somite rostral/caudal axis specification	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003007	heart morphogenesis	IBA	biological process
GO:0001707	mesoderm formation	IBA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0001947	heart looping	IEA	biological process
GO:0003139	secondary heart field specification	IEA	biological process
GO:0003241	growth involved in heart morphogenesis	IEA	biological process
GO:0003259	cardioblast anterior-lateral migration	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0008078	mesodermal cell migration	IEA	biological process
GO:0023019	signal transduction involved in regulation of gene expression	IEA	biological process
GO:0035481	positive regulation of Notch signaling pathway involved in heart induction	IEA	biological process
GO:0045747	positive regulation of Notch signaling pathway	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0060913	cardiac cell fate determination	IEA	biological process
GO:0070368	positive regulation of hepatocyte differentiation	IEA	biological process
GO:0003007	heart morphogenesis	IEA	biological process
GO:0003143	embryonic heart tube morphogenesis	IEA	biological process
GO:0003236	sinus venosus morphogenesis	IEA	biological process
GO:0003260	cardioblast migration	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007369	gastrulation	IEA	biological process
GO:0010467	gene expression	IEA	biological process
GO:0042662	negative regulation of mesodermal cell fate specification	IEA	biological process
GO:0042664	negative regulation of endodermal cell fate specification	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0048368	lateral mesoderm development	IEA	biological process
GO:0051155	positive regulation of striated muscle cell differentiation	IEA	biological process
GO:0060975	cardioblast migration to the midline involved in heart field formation	IEA	biological process
GO:0090082	positive regulation of heart induction by negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0005634	nucleus	IC	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0001947	heart looping	ISS	biological process
GO:0003139	secondary heart field specification	ISS	biological process
GO:0003210	cardiac atrium formation	IMP	biological process
GO:0003241	growth involved in heart morphogenesis	ISS	biological process
GO:0003259	cardioblast anterior-lateral migration	ISS	biological process
GO:0022008	neurogenesis	IMP	biological process
GO:0045747	positive regulation of Notch signaling pathway	ISS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0060913	cardiac cell fate determination	ISS	biological process
GO:0060921	sinoatrial node cell differentiation	IMP	biological process
GO:0070368	positive regulation of hepatocyte differentiation	ISS	biological process
GO:0003143	embryonic heart tube morphogenesis	ISS	biological process
GO:0003211	cardiac ventricle formation	IMP	biological process
GO:0003236	sinus venosus morphogenesis	ISS	biological process
GO:0007369	gastrulation	ISS	biological process
GO:0042662	negative regulation of mesodermal cell fate specification	ISS	biological process
GO:0042664	negative regulation of endodermal cell fate specification	ISS	biological process
GO:0045446	endothelial cell differentiation	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0048368	lateral mesoderm development	ISS	biological process
GO:0051155	positive regulation of striated muscle cell differentiation	ISS	biological process
GO:0055007	cardiac muscle cell differentiation	IMP	biological process
GO:0060947	cardiac vascular smooth muscle cell differentiation	IMP	biological process
GO:0060975	cardioblast migration to the midline involved in heart field formation	ISS	biological process
GO:0090082	positive regulation of heart induction by negative regulation of canonical Wnt signaling pathway	ISS	biological process
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881