• Gene id: 55893

Gene Summary

• Gene Symbol: ZNF395   Gene   UCSC   Ensembl
• Aliases: HDBP-2, HDBP2, HDRF-2, PBF, PRF-1, PRF1, Si-1-8-14
• Gene name: zinc finger protein 395
• Alternate names: zinc finger protein 395, HD gene regulatory region-binding protein 2, HD-regulating factor 2, Huntington's disease gene regulatory region-binding protein 2, huntington disease gene regulatory region-binding protein 2, papillomavirus regulatory factor 1, papillo,
• Gene location: 8p21.1 (28386459: 28345589)     Exons: 10     NC_000008.11
• OMIM: 602681

Protein Summary

• Protein general information: Q9H8N7  
  • Name: Zinc finger protein 395 (HD regulating factor 2) (HDRF 2) (Huntington disease gene regulatory region binding protein 2) (HD gene regulatory region binding protein 2) (HDBP 2) (Papillomavirus regulatory factor 1) (PRF 1) (Papillomavirus binding factor)
  • Length: 513  
  • Mass: 54939
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MASVLSRRLGKRSLLGARVLGPSASEGPSAAPPSEPLLEGAAPQPFTTSDDTPCQEQPKEVLKAPSTSGLQQVAF
  QPGQKVYVWYGGQECTGLVEQHSWMEGQVTVWLLEQKLQVCCRVEEVWLAELQGPCPQAPPLEPGAQALAYRPVS
  RNIDVPKRKSDAVEMDEMMAAMVLTSLSCSPVVQSPPGTEANFSASRAACDPWKESGDISDSGSSTTSGHWSGSS
  GVSTPSPPHPQASPKYLGDAFGSPQTDHGFETDPDPFLLDEPAPRKRKNSVKVMYKCLWPNCGKVLRSIVGIKRH
  VKALHLGDTVDSDQFKREEDFYYTEVQLKEESAAAAAAAAAGTPVPGTPTSEPAPTPSMTGLPLSALPPPLHKAQ
  SSGPEHPGPESSLPSGALSKSAPGSFWHIQADHAYQALPSFQIPVSPHIYTSVSWAAAPSAACSLSPVRSRSLSF
  SEPQQPAPAMKSHLIVTSPPRAQSGARKARGEAKKCRKVYGIEHRDQWCTACRWKKACQRFLD

• Structural information:
  • Interpro: IPR031940  IPR013087  
  • Prosite: PS00028 PS50157
  • STRING: ENSP00000340494
• Other Databases: GeneCards:  ZNF395  Malacards:  ZNF395

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0000987	cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IC	biological process
GO:0003677	DNA binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray