• Gene id: 55891

Gene Summary

• Gene Symbol: LENEP   Gene   UCSC   Ensembl
• Aliases: LEP503
• Gene name: lens epithelial protein
• Alternate names: lens epithelial cell protein LEP503,
• Gene location: 1q21.3 (127588410: 127591699)     Exons: 6     NC_000007.14
• Gene summary(Entrez): The ocular lens is a tissue of epithelial origin and devoid of blood vessels and nerves. Cells of the lens epithelium are responsible for the growth and maintenance of the lens through mitosis, protein synthesis, and active transport of ions and metabolit
• OMIM: 607377

Protein Summary

• Protein general information: Q9Y5L5  
  • Name: Lens epithelial cell protein LEP503
  • Length: 61  
  • Mass: 6908
  • Tissue specificity: Restricted to lens epithelial cells. {ECO
• Sequence:

  MQPRTQPLAQTLPFFLGGAPRDTGLRVPVIKMGTGWEGFQRTLKEVAYILLCCWCIKELLD

• Structural information:
  • Interpro: IPR029194  
  • STRING: ENSP00000376278
• Other Databases: GeneCards:  LENEP  Malacards:  LENEP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007275	multicellular organism development	IEA	biological process
GO:0003677	DNA binding	TAS	molecular function
GO:0007275	multicellular organism development	TAS	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)