• Gene id: 55890

Gene Summary

• Gene Symbol: GPRC5C   Gene   UCSC   Ensembl
• Aliases: RAIG-3, RAIG3
• Gene name: G protein-coupled receptor class C group 5 member C
• Alternate names: G-protein coupled receptor family C group 5 member C, orphan G-protein coupled receptor, retinoic acid responsive gene protein, retinoic acid-induced gene 3 protein,
• Gene location: 17q25.1 (74431349: 74451657)     Exons: 7     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the type 3 G protein-coupled receptor family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. The specific function of this protein is unknown; however, this protei
• OMIM: 606732

Protein Summary

• Protein general information: Q9NQ84  
  • Name: G protein coupled receptor family C group 5 member C (Retinoic acid induced gene 3 protein) (RAIG 3)
  • Length: 441  
  • Mass: 48193
  • Tissue specificity: Expression is highest in the periphery, particularly in the stomach, but also in the kidney, liver, pancreas, and prostate. In brain, levels of expression are generally lower than in the periphery, with the exception of cerebellum, spi
• Sequence:

  MAIHKALVMCLGLPLFLFPGAWAQGHVPPGCSQGLNPLYYNLCDRSGAWGIVLEAVAGAGIVTTFVLTIILVASL
  PFVQDTKKRSLLGTQVFFLLGTLGLFCLVFACVVKPDFSTCASRRFLFGVLFAICFSCLAAHVFALNFLARKNHG
  PRGWVIFTVALLLTLVEVIINTEWLIITLVRGSGEGGPQGNSSAGWAVASPCAIANMDFVMALIYVMLLLLGAFL
  GAWPALCGRYKRWRKHGVFVLLTTATSVAIWVVWIVMYTYGNKQHNSPTWDDPTLAIALAANAWAFVLFYVIPEV
  SQVTKSSPEQSYQGDMYPTRGVGYETILKEQKGQSMFVENKAFSMDEPVAAKRPVSPYSGYNGQLLTSVYQPTEM
  ALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQAATPPKDGKNSQVFRNPYVWD

• Structural information:
  • Interpro: IPR017978  
  • Prosite: PS50259
  • STRING: ENSP00000376403
• Other Databases: GeneCards:  GPRC5C  Malacards:  GPRC5C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070062	extracellular exosome	IBA	cellular component
GO:0043235	receptor complex	IBA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0030295	protein kinase activator activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0031982	vesicle	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R