• Gene id: 55889

Gene Summary

• Gene Symbol: GOLGA6B   Gene   UCSC   Ensembl
• Aliases: GOLGA, GOLGA6D
• Gene name: golgin A6 family member B
• Alternate names: golgin subfamily A member 6B, Golgin subfamily A member 6B, Putative golgin subfamily A member 6D, golgi autoantigen, golgin subfamily a, 6B, golgin-like protein, putative golgin subfamily A member 6B,
• Gene location: 15q24.1 (72654696: 72667396)     Exons: 13     NC_000015.10
• Gene summary(Entrez): This gene is found in a large, low copy repeat sequence or duplicon that is found in multiple copies, which are greater than 90% similar, on chromosome 15. Duplicons are associated with deletions, inversions and other chromosomal rearrangements that under

Protein Summary

• Protein general information: A6NDN3  
  • Name: Golgin subfamily A member 6B
  • Length: 693  
  • Mass: 79913
• Sequence:

  MWPQPYLPPHPMMLEESRQNKLAAAKKKLKEYQQRKSPGIPAGAKTKKKKTDSSPETTTSGGGHSPGDSQYQELA
  VALESSSVTISQLNENIESLKQQKKQVEHQLEEAKKTNNEIHKAQMERLETINILTLEKADLKTTLYHTKRAARH
  FEEESKDLAGRLQYSLQRIQELERALCAVSTQQQEEDRSSSCREAVLHRRLQQTIKERALLNAHVTQVTESLKQV
  QLERDEYAKHIKGERARWQERMWKMSVEARTLKEEKKRDIHRIQELERSLSELKNQMAKPPSLAPPAVTSVVEQL
  QDEAKHLRQEVEGLEGKLQSQVENNQALSLLSKEQKQRLQEQEEMLREQEVQRVREQERLCEQNERLREQQKTLQ
  EQGERLRKQEQRLRKQEERLRKEEERLQKQEKRLWDQEERLWKKEERLQKQEERLALSQNHKLDKQLAEPQCSFE
  DLNNEKKSALQLEQQVKELQEKLDEEHLEAASQQNQQLETQLSLVALPGEGDGGQHLDSEEEEAPRPTPNIPEDL
  ESREATSSFMDLPKEKADGTEQVERRELGFVQPSGVTDGMRESFTVYESQGAVPNTRHQEMEDVIRLAQKEEEMK
  VKLLELQELVLPLVGNHEGHGKFLIAAQNPADEPTPGAPAPQELGAAGEQDDFYEVSLDNNVEPAPGAAREGSPH
  DNPTVQQIVQLSPVMQDT

• Structural information:
  • Interpro: IPR024858  
  • STRING: ENSP00000408132
• Other Databases: GeneCards:  GOLGA6B  Malacards:  GOLGA6B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005801	cis-Golgi network	IBA	cellular component
GO:0000137	Golgi cis cisterna	IBA	cellular component
GO:0007030	Golgi organization	IBA	biological process
GO:0032580	Golgi cisterna membrane	IBA	cellular component
GO:0051225	spindle assembly	IBA	NOT|biological process
GO:0005794	Golgi apparatus	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray