• Gene id: 55885

Gene Summary

• Gene Symbol: LMO3   Gene   UCSC   Ensembl
• Aliases: RBTN3, RBTNL2, RHOM3, Rhom-3
• Gene name: LIM domain only 3
• Alternate names: LIM domain only protein 3, LIM domain only 3 (rhombotin-like 2), neuronal-specific transcription factor DAT1, rhombotin-3,
• Gene location: 12p12.3 (16610232: 16548371)     Exons: 13     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the rhombotin family of cysteine-rich LIM domain oncogenes. This gene is predominantly expressed in the brain. Related family members, LMO1 and LMO2 on chromosome 11, have been reported to be involved in chromos
• OMIM: 180386

Protein Summary

• Protein general information: Q8TAP4  
  • Name: LIM domain only protein 3 (LMO 3) (Neuronal specific transcription factor DAT1) (Rhombotin 3)
  • Length: 145  
  • Mass: 16594
• Sequence:

  MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTG
  NCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQVR

• Structural information:
  • Protein Domains: (11..7-)
    1 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125-)
    (75..13-)
    2 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125"-)
  • Interpro: IPR001781  
  • Prosite: PS00478 PS50023
  • DIP: 50129
• Other Databases: GeneCards:  LMO3  Malacards:  LMO3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046872	metal ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0035360	positive regulation of peroxisome proliferator activated receptor signaling pathway	IDA	biological process
GO:2000324	positive regulation of glucocorticoid receptor signaling pathway	IDA	biological process
GO:0045600	positive regulation of fat cell differentiation	IMP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray