• Gene id: 5588

Gene Summary

• Gene Symbol: PRKCQ   Gene   UCSC   Ensembl
• Aliases: PRKCT, nPKC-theta
• Gene name: protein kinase C theta
• Alternate names: protein kinase C theta type,
• Gene location: 10p15.1 (6580645: 6393037)     Exons: 23     NC_000010.11
• Gene summary(Entrez): Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved
• OMIM: 600448

Protein Summary

• Protein general information: Q04759  
  • Name: Protein kinase C theta type (EC 2.7.11.13) (nPKC theta)
  • Length: 706  
  • Mass: 81865
  • Tissue specificity: Expressed in skeletal muscle, T-cells, megakaryoblastic cells and platelets. {ECO
• Sequence:

  MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTFDAHINKGRVMQIIVK
  GKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNARYFLEMSDTKDMNEFETEGFFALHQRRGAIK
  QAKVHHVKCHEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKER
  FKIDMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQ
  ARCLRDTEQIFREGPVEIGLPCSIKNEARPPCLPTPGKREPQGISWESPLDEVDKMCHLPEPELNKERPSLQIKL
  KIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQT
  KENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGM
  CKENMLGDAKTNTFCGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPR
  WLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPFDCSNFDKEFLNEKPRL
  SFADRALINSMDQNMFRNFSFMNPGMERLIS

• Structural information:
  • Protein Domains: (1..10-)
    (/note="C2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (380..63-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (635..70-)
    (/note="AGC-kinase-C-terminal")
  • Interpro: IPR000961  IPR035892  IPR020454  IPR011009  IPR034668   IPR002219  IPR027264  IPR017892  IPR014376  IPR000719  IPR017441  IPR008271  
  • Prosite: PS51285 PS50004 PS00107 PS50011 PS00108 PS00479 PS50081
  • CDD: cd00029 cd05619
  • PDB: 1XJD 2ENJ 2ENN 2ENZ 2JED 4Q9Z 4RA5 5F9E
  • PDBsum: 1XJD 2ENJ 2ENN 2ENZ 2JED 4Q9Z 4RA5 5F9E
  • STRING: ENSP00000263125
• Other Databases: GeneCards:  PRKCQ  Malacards:  PRKCQ

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0032753	positive regulation of interleukin-4 production	ISS	biological process
GO:2000570	positive regulation of T-helper 2 cell activation	ISS	biological process
GO:2000318	positive regulation of T-helper 17 type immune response	ISS	biological process
GO:0090330	regulation of platelet aggregation	ISS	biological process
GO:0070233	negative regulation of T cell apoptotic process	IMP	biological process
GO:0070233	negative regulation of T cell apoptotic process	IMP	biological process
GO:0050870	positive regulation of T cell activation	ISS	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	IMP	biological process
GO:0032740	positive regulation of interleukin-17 production	ISS	biological process
GO:0006355	regulation of transcription, DNA-templated	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004697	protein kinase C activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004698	calcium-dependent protein kinase C activity	IEA	molecular function
GO:0004697	protein kinase C activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007411	axon guidance	TAS	biological process
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0030168	platelet activation	TAS	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0045652	regulation of megakaryocyte differentiation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0045086	positive regulation of interleukin-2 biosynthetic process	IEA	biological process
GO:0032753	positive regulation of interleukin-4 production	IEA	biological process
GO:0006509	membrane protein ectodomain proteolysis	IEA	biological process
GO:0004697	protein kinase C activity	IEA	molecular function
GO:0001772	immunological synapse	IEA	cellular component
GO:2000570	positive regulation of T-helper 2 cell activation	IEA	biological process
GO:2000318	positive regulation of T-helper 17 type immune response	IEA	biological process
GO:0090330	regulation of platelet aggregation	IEA	biological process
GO:0050870	positive regulation of T cell activation	IEA	biological process
GO:0042102	positive regulation of T cell proliferation	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0032740	positive regulation of interleukin-17 production	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0032212	positive regulation of telomere maintenance via telomerase	IMP	biological process
GO:1904355	positive regulation of telomere capping	IMP	biological process
GO:0006509	membrane protein ectodomain proteolysis	ISS	biological process
GO:0051973	positive regulation of telomerase activity	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component
GO:0016235	aggresome	IDA	cellular component
GO:0001558	regulation of cell growth	NAS	biological process
GO:0035556	intracellular signal transduction	NAS	biological process
GO:0004674	protein serine/threonine kinase activity	NAS	molecular function
GO:0060326	cell chemotaxis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis
hsa04140	Autophagy - animal
hsa04270	Vascular smooth muscle contraction
hsa04064	NF-kappa B signaling pathway
hsa04660	T cell receptor signaling pathway
hsa04931	Insulin resistance
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04659	Th17 cell differentiation
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa04658	Th1 and Th2 cell differentiation
hsa04920	Adipocytokine signaling pathway
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Type 1 diabetes mellitus	KEGG:H00408
Type 1 diabetes mellitus	KEGG:H00408
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq