• Gene id: 55876

Gene Summary

• Gene Symbol: GSDMB   Gene   UCSC   Ensembl
• Aliases: GSDMB-1, GSDML, PP4052, PRO2521
• Gene name: gasdermin B
• Alternate names: gasdermin-B, gasdermin-like protein, gasderminB-1,
• Gene location: 17q21.1 (39918649: 39904594)     Exons: 11     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the gasdermin-domain containing protein family. Other gasdermin-family genes are implicated in the regulation of apoptosis in epithelial cells, and are linked to cancer. Alternative splicing and the use of alternative promote
• OMIM: 611221

Protein Summary

• Protein general information: Q8TAX9  
  • Name: Gasdermin B (Gasdermin like protein)
  • Length: 411  
  • Mass: 46786
  • Tissue specificity: In the gastrointestinal tract, expressed in proliferating cells, including in the basal cell layer of esophagus and in isthmus/neck of stomach. {ECO
• Sequence:

  MFSVFEEITRIVVKEMDAGGDMIAVRSLVDADRFRCFHLVGEKRTFFGCRHYTTGLTLMDILDTDGDKWLDELDS
  GLQGQKAEFQILDNVDSTGELIVRLPKEITISGSFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSIN
  TRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVTIPPNRVLSYRVKQLVFPNKETMSAGLD
  IHFRGKTKSFPEGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVLISGE
  LHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDELAS
  SPPDMDYDPEARILCALYVVVSILLELAEGPTSVSS

• Structural information:
  • Interpro: IPR007677  IPR040460  IPR041263  
  • PDB: 5TIB 5TJ2 5TJ4
  • PDBsum: 5TIB 5TJ2 5TJ4
  • STRING: ENSP00000415049
• Other Databases: GeneCards:  GSDMB  Malacards:  GSDMB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070273	phosphatidylinositol-4-phosphate binding	IBA	molecular function
GO:0001786	phosphatidylserine binding	IBA	molecular function
GO:0070269	pyroptosis	IBA	biological process
GO:0042742	defense response to bacterium	IBA	biological process
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IBA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0012501	programmed cell death	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005575	cellular_component	ND	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881