• Gene id: 5587

Gene Summary

• Gene Symbol: PRKD1   Gene   UCSC   Ensembl
• Aliases: CHDED, PKC-MU, PKCM, PKD, PRKCM
• Gene name: protein kinase D1
• Alternate names: serine/threonine-protein kinase D1, nPKC-D1, nPKC-mu, protein kinase C mu type, protein kinase C, mu, protein kinase D,
• Gene location: 14q12 (151060396: 151069543)     Exons: 2     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a serine/threonine protein kinase involved in many cellular processes, including Golgi body membrane integrity and transport, cell migration and differentiation, MAPK8/JNK1 and Ras pathway signaling, MAPK1/3 (ERK1/2) pa
• OMIM: 605435

Protein Summary

• Protein general information: Q15139  
  • Name: Serine/threonine protein kinase D1 (EC 2.7.11.13) (Protein kinase C mu type) (Protein kinase D) (nPKC D1) (nPKC mu)
  • Length: 912  
  • Mass: 101704
• Sequence:

  MSAPPVLRPPSPLLPVAAAAAAAAAALVPGSGPGPAPFLAPVAAPVGGISFHLQIGLSREPVLLLQDSSGDYSLA
  HVREMACSIVDQKFPECGFYGMYDKILLFRHDPTSENILQLVKAASDIQEGDLIEVVLSASATFEDFQIRPHALF
  VHSYRAPAFCDHCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRRRRLSNVSLTGVSTIRTSSAELSTS
  APDEPLLQKSPSESFIGREKRSNSQSYIGRPIHLDKILMSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQ
  CKDCRFNCHKRCAPKVPNNCLGEVTINGDLLSPGAESDVVMEEGSDDNDSERNSGLMDDMEEAMVQDAEMAMAEC
  QNDSGEMQDPDPDHEDANRTISPSTSNNIPLMRVVQSVKHTKRKSSTVMKEGWMVHYTSKDTLRKRHYWRLDSKC
  ITLFQNDTGSRYYKEIPLSEILSLEPVKTSALIPNGANPHCFEITTANVVYYVGENVVNPSSPSPNNSVLTSGVG
  ADVARMWEIAIQHALMPVIPKGSSVGTGTNLHRDISVSISVSNCQIQENVDISTVYQIFPDEVLGSGQFGIVYGG
  KHRKTGRDVAIKIIDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFETPERVFVVMEKLHGDMLEMILSSEK
  GRLPEHITKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYL
  APEVLRNKGYNRSLDMWSVGVIIYVSLSGTFPFNEDEDIHDQIQNAAFMYPPNPWKEISHEAIDLINNLLQVKMR
  KRYSVDKTLSHPWLQDYQTWLDLRELECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEET
  EMKALGERVSIL

• Structural information:
  • Protein Domains: (422..54-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (583..83-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR020454  IPR011009  IPR002219  IPR011993  IPR001849   IPR000719  IPR017441  IPR015727  IPR008271  
  • Prosite: PS50003 PS00107 PS50011 PS00108 PS00479 PS50081
  • CDD: cd00029
  • DIP: 38481
  • STRING: ENSP00000333568
• Other Databases: GeneCards:  PRKD1  Malacards:  PRKD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0018107	peptidyl-threonine phosphorylation	ISS	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity	IC	biological process
GO:0000421	autophagosome membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0071447	cellular response to hydroperoxide	IMP	biological process
GO:0018107	peptidyl-threonine phosphorylation	IDA	biological process
GO:0034198	cellular response to amino acid starvation	IMP	biological process
GO:0010508	positive regulation of autophagy	IMP	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0004697	protein kinase C activity	IDA	molecular function
GO:0089700	protein kinase D signaling	IBA	biological process
GO:0034599	cellular response to oxidative stress	IDA	biological process
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0016301	kinase activity	IDA	molecular function
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0060548	negative regulation of cell death	IMP	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0045669	positive regulation of osteoblast differentiation	ISS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0010595	positive regulation of endothelial cell migration	IMP	biological process
GO:0005829	cytosol	ISS	cellular component
GO:0007265	Ras protein signal transduction	IMP	biological process
GO:0048193	Golgi vesicle transport	ISS	biological process
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IMP	biological process
GO:0010976	positive regulation of neuron projection development	IMP	biological process
GO:0010837	regulation of keratinocyte proliferation	ISS	biological process
GO:0007030	Golgi organization	IMP	biological process
GO:0031647	regulation of protein stability	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0006954	inflammatory response	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0004698	calcium-dependent protein kinase C activity	IEA	molecular function
GO:0004697	protein kinase C activity	IEA	molecular function
GO:0030148	sphingolipid biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0007229	integrin-mediated signaling pathway	TAS	biological process
GO:0032793	positive regulation of CREB transcription factor activity	IGI	biological process
GO:0089700	protein kinase D signaling	IGI	biological process
GO:0043536	positive regulation of blood vessel endothelial cell migration	IMP	biological process
GO:0043536	positive regulation of blood vessel endothelial cell migration	IGI	biological process
GO:0045806	negative regulation of endocytosis	TAS	biological process
GO:0046777	protein autophosphorylation	TAS	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IMP	biological process
GO:2001028	positive regulation of endothelial cell chemotaxis	IMP	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IGI	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IGI	biological process
GO:0035556	intracellular signal transduction	IMP	biological process
GO:0035556	intracellular signal transduction	IMP	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IMP	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IMP	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IGI	biological process
GO:0038033	positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway	IMP	biological process
GO:0038033	positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway	IGI	biological process
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:0045766	positive regulation of angiogenesis	IGI	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:1901727	positive regulation of histone deacetylase activity	IGI	biological process
GO:2001044	regulation of integrin-mediated signaling pathway	TAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0018107	peptidyl-threonine phosphorylation	IMP	biological process
GO:0004674	protein serine/threonine kinase activity	IMP	molecular function
GO:0018105	peptidyl-serine phosphorylation	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04015	Rap1 signaling pathway
hsa04925	Aldosterone synthesis and secretion
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray