• Gene id: 55867

Gene Summary

• Gene Symbol: SLC22A11   Gene   UCSC   Ensembl
• Aliases: OAT4, hOAT4
• Gene name: solute carrier family 22 member 11
• Alternate names: solute carrier family 22 member 11, organic anion transporter 4, solute carrier family 22 (organic anion/cation transporter), member 11, solute carrier family 22 (organic anion/urate transporter), member 11,
• Gene location: 11q13.1 (64555846: 64572874)     Exons: 10     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and is found mainly in the kidney and in the placent
• OMIM: 611219

Protein Summary

• Protein general information: Q9NSA0  
  • Name: Solute carrier family 22 member 11 (Organic anion transporter 4)
  • Length: 550  
  • Mass: 59972
  • Tissue specificity: Detected in placenta and kidney. {ECO
• Sequence:

  MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCWTHMLDNGSAVSTNMTPKALLTISIP
  PGPNQGPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGWVYDRSVFTSTIVAKWDLVCSSQGLKPLSQSIFM
  SGILVGSFIWGLLSYRFGRKPMLSWCCLQLAVAGTSTIFAPTFVIYCGLRFVAAFGMAGIFLSSLTLMVEWTTTS
  RRAVTMTVVGCAFSAGQAALGGLAFALRDWRTLQLAASVPFFAISLISWWLPESARWLIIKGKPDQALQELRKVA
  RINGHKEAKNLTIEVLMSSVKEEVASAKEPRSVLDLFCVPVLRWRSCAMLVVNFSLLISYYGLVFDLQSLGRDIF
  LLQALFGAVDFLGRATTALLLSFLGRRTIQAGSQAMAGLAILANMLVPQDLQTLRVVFAVLGKGCFGISLTCLTI
  YKAELFPTPVRMTADGILHTVGRLGAMMGPLILMSRQALPLLPPLLYGVISIASSLVVLFFLPETQGLPLPDTIQ
  DLESQKSTAAQGNRQEAVTVESTSL

• Structural information:
  • Interpro: IPR020846  IPR005828  IPR036259  
  • Prosite: PS50850
  • STRING: ENSP00000301891
• Other Databases: GeneCards:  SLC22A11  Malacards:  SLC22A11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015711	organic anion transport	IBA	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0046415	urate metabolic process	IMP	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0015698	inorganic anion transport	IEA	biological process
GO:0015347	sodium-independent organic anion transmembrane transporter activity	IDA	molecular function
GO:0008514	organic anion transmembrane transporter activity	IDA	molecular function
GO:0008514	organic anion transmembrane transporter activity	IDA	molecular function
GO:0008514	organic anion transmembrane transporter activity	IDA	molecular function
GO:0005452	inorganic anion exchanger activity	IDA	molecular function
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0015711	organic anion transport	IDA	biological process
GO:0015711	organic anion transport	IDA	biological process
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq