• Gene id: 55860

Gene Summary

• Gene Symbol: ACTR10   Gene   UCSC   Ensembl
• Aliases: ACTR11, Arp10, Arp11, HARP11
• Gene name: actin related protein 10
• Alternate names: actin-related protein 10, actin related protein 10 homolog, actin-related protein 11,
• Gene location: 14q23.1 (58200148: 58235635)     Exons: 13     NC_000014.9

Protein Summary

• Protein general information: Q9NZ32  
  • Name: Actin related protein 10 (Actin related protein 11) (hARP11)
  • Length: 417  
  • Mass: 46307
• Sequence:

  MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKRAGMPKPVRVVQYNINTEELYSYLKEFIHIL
  YFRHLLVNPRDRRVVIIESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLP
  IYEGIPVLNCWGALPLGGKALHKELETQLLEQCTVDTSVAKEQSLPSVMGSVPEGVLEDIKARTCFVSDLKRGLK
  IQAAKFNIDGNNERPSPPPNVDYPLDGEKILHILGSIRDSVVEILFEQDNEEQSVATLILDSLIQCPIDTRKQLA
  ENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKALGTKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSK
  EYYNQTGRIPDWCSLNNPPLEMMFDVGKTQPPLMKRAFSTEK

• Structural information:
  • Interpro: IPR004000  IPR027127  
  • STRING: ENSP00000254286
• Other Databases: GeneCards:  ACTR10  Malacards:  ACTR10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0106006	cytoskeletal protein-membrane anchor activity	IBA	contributes to
GO:0099738	cell cortex region	IBA	cellular component
GO:0030473	nuclear migration along microtubule	IBA	biological process
GO:0007018	microtubule-based movement	IBA	biological process
GO:0005869	dynactin complex	IBA	cellular component
GO:0005813	centrosome	IBA	cellular component
GO:0000132	establishment of mitotic spindle orientation	IBA	biological process
GO:0098958	retrograde axonal transport of mitochondrion	IBA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005869	dynactin complex	IEA	cellular component
GO:0007018	microtubule-based movement	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05016	Huntington disease

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)