• Gene id: 5586

Gene Summary

• Gene Symbol: PKN2   Gene   UCSC   Ensembl
• Aliases: PAK2, PRK2, PRKCL2, PRO2042, Pak-2, STK7
• Gene name: protein kinase N2
• Alternate names: serine/threonine-protein kinase N2, PKN gamma, cardiolipin-activated protein kinase Pak2, protein kinase C-like 2, protein-kinase C-related kinase 2,
• Gene location: 1p22.2 (88684143: 88836254)     Exons: 23     NC_000001.11
• OMIM: 602549

Protein Summary

• Protein general information: Q16513  
  • Name: Serine/threonine protein kinase N2 (EC 2.7.11.13) (PKN gamma) (Protein kinase C like 2) (Protein kinase C related kinase 2)
  • Length: 984  
  • Mass: 112035
  • Tissue specificity: Ubiquitous. Expressed in numerous tumor cell lines, especially in bladder tumor cells. {ECO
• Sequence:

  MASNPERGEILLTELQGDSRSLPFSENVSAVQKLDFSDTMVQQKLDDIKDRIKREIRKELKIKEGAENLRKVTTD
  KKSLAYVDNILKKSNKKLEELHHKLQELNAHIVVSDPEDITDCPRTPDTPNNDPRCSTSNNRLKALQKQLDIELK
  VKQGAENMIQMYSNGSSKDRKLHGTAQQLLQDSKTKIEVIRMQILQAVQTNELAFDNAKPVISPLELRMEELRHH
  FRIEFAVAEGAKNVMKLLGSGKVTDRKALSEAQARFNESSQKLDLLKYSLEQRLNEVPKNHPKSRIIIEELSLVA
  ASPTLSPRQSMISTQNQYSTLSKPAALTGTLEVRLMGCQDILENVPGRSKATSVALPGWSPSETRSSFMSRTSKS
  KSGSSRNLLKTDDLSNDVCAVLKLDNTVVGQTSWKPISNQSWDQKFTLELDRSRELEISVYWRDWRSLCAVKFLR
  LEDFLDNQRHGMCLYLEPQGTLFAEVTFFNPVIERRPKLQRQKKIFSKQQGKTFLRAPQMNINIATWGRLVRRAI
  PTVNHSGTFSPQAPVPTTVPVVDVRIPQLAPPASDSTVTKLDFDLEPEPPPAPPRASSLGEIDESSELRVLDIPG
  QDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFRCCAVLGRGHFGKVLLAE
  YKNTNEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFLVNLFACFQTKEHVCFVMEYAAGGDLMMHIH
  TDVFSEPRAVFYAACVVLGLQYLHEHKIVYRDLKLDNLLLDTEGFVKIADFGLCKEGMGYGDRTSTFCGTPEFLA
  PEVLTETSYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRL
  GASEKDAEDVKKHPFFRLIDWSALMDKKVKPPFIPTIRGREDVSNFDDEFTSEAPILTPPREPRILSEEEQEMFR
  DFDYIADWC

• Structural information:
  • Protein Domains: (33..10-)
    (/note="REM-1-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01207-)
    (121..20-)
    (/note="REM-1-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01207-)
    (204..28-)
    (/note="REM-1-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01207"-)
  • Interpro: IPR000961  IPR000008  IPR037784  IPR011072  IPR036274   IPR011009  IPR017892  IPR037313  IPR000719  IPR017441  IPR008271  
  • Prosite: PS51285 PS50004 PS00107 PS50011 PS00108 PS51860
  • CDD: cd08687 cd11622
  • PDB: 4CRS 4RRV 6CCY 6GBE
  • PDBsum: 4CRS 4RRV 6CCY 6GBE
  • STRING: ENSP00000359552
• Other Databases: GeneCards:  PKN2  Malacards:  PKN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0043296	apical junction complex	IDA	cellular component
GO:0010631	epithelial cell migration	IDA	biological process
GO:0042826	histone deacetylase binding	IDA	molecular function
GO:0032154	cleavage furrow	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0030027	lamellipodium	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:2000145	regulation of cell motility	IMP	biological process
GO:0045931	positive regulation of mitotic cell cycle	IMP	biological process
GO:0043297	apical junction assembly	IMP	biological process
GO:0032467	positive regulation of cytokinesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0017049	GTP-Rho binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0030030	cell projection organization	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0004672	protein kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0004697	protein kinase C activity	IEA	molecular function
GO:0004698	calcium-dependent protein kinase C activity	IEA	molecular function
GO:0016301	kinase activity	IDA	molecular function
GO:0070063	RNA polymerase binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0045070	positive regulation of viral genome replication	IMP	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032991	protein-containing complex	IEA	cellular component
GO:0043296	apical junction complex	IEA	cellular component
GO:0043297	apical junction assembly	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045296	cadherin binding	HDA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0032154	cleavage furrow	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0045111	intermediate filament cytoskeleton	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04621	NOD-like receptor signaling pathway
hsa05135	Yersinia infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R