• Gene id: 55859

Gene Summary

• Gene Symbol: BEX1   Gene   UCSC   Ensembl
• Aliases: BEX2, HBEX2, HGR74-h
• Gene name: brain expressed X-linked 1
• Alternate names: protein BEX1, brain-expressed X-linked protein 1, ovarian granulosa cell 13.0 kDa protein hGR74,
• Gene location: Xq22 (103064170: 103062650)     Exons: 3     NC_000023.11
• OMIM: 300690

Protein Summary

• Protein general information: Q9HBH7  
  • Name: Protein BEX1 (Brain expressed X linked protein 1)
  • Length: 125  
  • Mass: 14860
  • Tissue specificity: Expressed in central nervous system, with high level in pituitary, cerebellum and temporal lobe. Expressed in lung, skeletal muscle, peripheral blood leukocyte, stomach, lymph node, trachea and bone marrow. Highly expressed in acute my
• Sequence:

  MESKEKRAVNSLSMENANQENEEKEQVANKGEPLALPLDAGEYCVPRGNRRRFRVRQPILQYRWDMMHRLGEPQA
  RMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP

• Structural information:
  • Interpro: IPR007623  IPR021156  
  • STRING: ENSP00000361813
• Other Databases: GeneCards:  BEX1  Malacards:  BEX1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001102	RNA polymerase II activating transcription factor binding	IPI	molecular function
GO:0005667	transcription regulator complex	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)