• Gene id: 55856

Gene Summary

• Gene Symbol: ACOT13   Gene   UCSC   Ensembl
• Aliases: HT012, PNAS-27, THEM2
• Gene name: acyl-CoA thioesterase 13
• Alternate names: acyl-coenzyme A thioesterase 13, hypothalamus protein HT012, thioesterase superfamily member 2,
• Gene location: 6p22.3 (24667034: 24705068)     Exons: 4     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the thioesterase superfamily. In humans, the protein co-localizes with microtubules and is essential for sustained cell proliferation. The orthologous mouse protein forms a homotetramer and is associated with mitochondria. Th
• OMIM: 615652

Protein Summary

• Protein general information: Q9NPJ3  
  • Name: Acyl coenzyme A thioesterase 13 (Acyl CoA thioesterase 13) (EC 3.1.2. ) (Thioesterase superfamily member 2) [Cleaved into: Acyl coenzyme A thioesterase 13, N terminally processed]
  • Length: 140  
  • Mass: 14960
• Sequence:

  MTSMTQSLREVIKAMTKARNFERVLGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDNISTMALLCT
  ERGAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHLGN

• Structural information:
  • Interpro: IPR039298  IPR029069  IPR003736  IPR006683  
  • PDB: 2F0X 2H4U 3F5O
  • PDBsum: 2F0X 2H4U 3F5O
  • STRING: ENSP00000230048
• Other Databases: GeneCards:  ACOT13  Malacards:  ACOT13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0047617	acyl-CoA hydrolase activity	IBA	molecular function
GO:0047617	acyl-CoA hydrolase activity	IDA	molecular function
GO:0047617	acyl-CoA hydrolase activity	IDA	molecular function
GO:0051289	protein homotetramerization	IPI	biological process
GO:0051289	protein homotetramerization	IPI	biological process
GO:0047617	acyl-CoA hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0006637	acyl-CoA metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0120163	negative regulation of cold-induced thermogenesis	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0120163	negative regulation of cold-induced thermogenesis	ISS	biological process
GO:0005634	nucleus	HDA	cellular component

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray