• Gene id: 55850

Gene Summary

• Gene Symbol: USE1   Gene   UCSC   Ensembl
• Aliases: D12, MDS032, P31, SLT1
• Gene name: unconventional SNARE in the ER 1
• Alternate names: vesicle transport protein USE1, Q-SNARE, SNARE-like tail-anchored protein 1 homolog, USE1-like protein, protein p31, putative MAPK activating protein PM26, unconventional SNARE in the ER 1 homolog,
• Gene location: 19p13.11 (17215345: 17219830)     Exons: 8     NC_000019.10
• OMIM: 610675

Protein Summary

• Protein general information: Q9NZ43  
  • Name: Vesicle transport protein USE1 (Putative MAPK activating protein PM26) (USE1 like protein) (p31)
  • Length: 259  
  • Mass: 29371
• Sequence:

  MAASRLELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASEVINEYSWKVDFLKGMLQAE
  KLTSSSEKALANQFLAPGRVPTTARERVPATKTVHLQSRARYTSEMRSELLGTDSAEPEMDVRKRTGVAGSQPVS
  EKQLAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQH
  TQKSVNWLLWAMLIIVCFIFISMILFIRIMPKLK

• Structural information:
  • Interpro: IPR019150  
  • STRING: ENSP00000263897
• Other Databases: GeneCards:  USE1  Malacards:  USE1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	ISS	NOT|biological process
GO:0007041	lysosomal transport	ISS	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005764	lysosome	ISS	NOT|cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030163	protein catabolic process	ISS	biological process
GO:0032940	secretion by cell	ISS	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030137	COPI-coated vesicle	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031201	SNARE complex	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04130	SNARE interactions in vesicular transport

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881