• Gene id: 55848

Gene Summary

• Gene Symbol: PLGRKT   Gene   UCSC   Ensembl
• Aliases: AD025, C9orf46, MDS030, PLG-RKT, Plg-R(KT)
• Gene name: plasminogen receptor with a C-terminal lysine
• Alternate names: plasminogen receptor (KT), 5033414D02Rik, plasminogen receptor, C-terminal lysine transmembrane protein, transmembrane protein C9orf46,
• Gene location: 9p24.1 (5438538: 5357965)     Exons: 8     NC_000009.12
• OMIM: 618444

Protein Summary

• Protein general information: Q9HBL7  
  • Name: Plasminogen receptor (KT) (Plg R(KT))
  • Length: 147  
  • Mass: 17201
  • Tissue specificity: Expressed in peripheral blood cells and monocytes. Expressed in adrenal medulla. {ECO
• Sequence:

  MGFIFSKSMNESMKNQKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSREFLKYFGTFFGLAAISLTAGAIKK
  KKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK

• Structural information:
  • Interpro: IPR019319  
  • STRING: ENSP00000223864
• Other Databases: GeneCards:  PLGRKT  Malacards:  PLGRKT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010756	positive regulation of plasminogen activation	IBA	biological process
GO:0010756	positive regulation of plasminogen activation	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0010756	positive regulation of plasminogen activation	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881