About Us

Search Result


Gene id 55844
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol PPP2R2D   Gene   UCSC   Ensembl
Aliases B55D, B55delta, MDS026
Gene name protein phosphatase 2 regulatory subunit Bdelta
Alternate names serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform, PP2A subunit B isoform B55-delta, PP2A subunit B isoform PR55-delta, PP2A subunit B isoform R2-delta, PP2A subunit B isoform delta, protein phosphatase 2 regulatory subunit B, d,
Gene location 10q26.3 (131900933: 131971534)     Exons: 12     NC_000010.11
OMIM 611344

Protein Summary

Protein general information Q66LE6  

Name: Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B delta isoform (PP2A subunit B isoform B55 delta) (PP2A subunit B isoform PR55 delta) (PP2A subunit B isoform R2 delta) (PP2A subunit B isoform delta)

Length: 453  Mass: 52042

Sequence MAGAGGGGCPAGGNDFQWCFSQVKGAIDEDVAEADIISTVEFNYSGDLLATGDKGGRVVIFQREQENKSRPHSRG
EYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAHFLLSTNDKTIKLWKISERDKRAEGYNLKDEDGRLR
DPFRITALRVPILKPMDLMVEASPRRIFANAHTYHINSISVNSDHETYLSADDLRINLWHLEITDRSFNIVDIKP
ANMEELTEVITAAEFHPHQCNVFVYSSSKGTIRLCDMRSSALCDRHSKFFEEPEDPSSRSFFSEIISSISDVKFS
HSGRYMMTRDYLSVKVWDLNMESRPVETHQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSAIMTGSYNNFFRMF
DRDTRRDVTLEASRESSKPRASLKPRKVCTGGKRRKDEISVDSLDFNKKILHTAWHPVDNVIAVAATNNLYIFQD
KIN
Structural information
Interpro:  IPR000009  IPR018067  IPR015943  IPR001680  IPR036322  
Prosite:   PS01024 PS01025
MINT:  
STRING:   ENSP00000399970
Other Databases GeneCards:  PPP2R2D  Malacards:  PPP2R2D

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0070262 peptidyl-serine dephospho
rylation
IBA biological process
GO:0005829 cytosol
IBA cellular component
GO:0019888 protein phosphatase regul
ator activity
IBA molecular function
GO:0000159 protein phosphatase type
2A complex
IBA cellular component
GO:0000278 mitotic cell cycle
ISS biological process
GO:0010458 exit from mitosis
ISS biological process
GO:0019888 protein phosphatase regul
ator activity
ISS molecular function
GO:0000159 protein phosphatase type
2A complex
ISS cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0000159 protein phosphatase type
2A complex
IEA cellular component
GO:0019888 protein phosphatase regul
ator activity
IEA molecular function
GO:0051301 cell division
IEA biological process
GO:0005737 cytoplasm
IEA cellular component
GO:0007049 cell cycle
IEA biological process
GO:0005515 protein binding
IPI molecular function
GO:0005737 cytoplasm
IEA cellular component
GO:0043666 regulation of phosphoprot
ein phosphatase activity
IEA biological process
GO:0043666 regulation of phosphoprot
ein phosphatase activity
IEA biological process
GO:0043666 regulation of phosphoprot
ein phosphatase activity
IEA biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04151PI3K-Akt signaling pathway
hsa05165Human papillomavirus infection
hsa04530Tight junction
hsa04390Hippo signaling pathway
hsa04261Adrenergic signaling in cardiomyocytes
hsa04728Dopaminergic synapse
hsa05160Hepatitis C
hsa04071Sphingolipid signaling pathway
hsa04152AMPK signaling pathway
hsa03015mRNA surveillance pathway
hsa05142Chagas disease
Associated diseases References
Cryptorchidism MIK: 28606200
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract