• Gene id: 55840

Gene Summary

• Gene Symbol: EAF2   Gene   UCSC   Ensembl
• Aliases: BM040, TRAITS, U19
• Gene name: ELL associated factor 2
• Alternate names: ELL-associated factor 2, testosterone-regulated apoptosis inducer and tumor suppressor protein,
• Gene location: 3q13.33 (121835179: 121886525)     Exons: 9     NC_000003.12
• OMIM: 605832

Protein Summary

• Protein general information: Q96CJ1  
  • Name: ELL associated factor 2 (Testosterone regulated apoptosis inducer and tumor suppressor protein)
  • Length: 260  
  • Mass: 28792
  • Tissue specificity: Expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, spleen, prostate, testis, small intestine, colon, adrenal, bone marrow, lymph node, spinal gland, stomach, thyroid, trachea, thymus, liver and leukocytes. {E
• Sequence:

  MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGSTPPVTV
  FKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNLVKHSPSEDKM
  SPASPIDDIERELKAEASLMDQMSSCDSSSDSKSSSSSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIP
  DIDASHNRFRDNSGLLMNTLRNDLQLSESGSDSDD

• Structural information:
  • Interpro: IPR027093  IPR019194  
  • STRING: ENSP00000273668
• Other Databases: GeneCards:  EAF2  Malacards:  EAF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0008023	transcription elongation factor complex	IDA	cellular component
GO:0032783	super elongation complex	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060770	negative regulation of epithelial cell proliferation involved in prostate gland development	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0030308	negative regulation of cell growth	IEA	biological process
GO:0005654	nucleoplasm	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component

Diseases

Associated diseases	References
Prostate cancer	PMID:12907652
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq