• Gene id: 55837

Gene Summary

• Gene Symbol: EAPP   Gene   UCSC   Ensembl
• Aliases: BM036, C14orf11
• Gene name: E2F associated phosphoprotein
• Alternate names: E2F-associated phosphoprotein,
• Gene location: 14q13.1 (109334346: 109345953)     Exons: 5     NC_000008.11
• Gene summary(Entrez): This gene encodes a phosphoprotein that interacts with several members of the E2F family of proteins. The protein localizes to the nucleus, and is present throughout the cell cycle except during mitosis. It functions to modulate E2F-regulated transcriptio
• OMIM: 609486

Protein Summary

• Protein general information: Q56P03  
  • Name: E2F associated phosphoprotein (EAPP)
  • Length: 285  
  • Mass: 32762
  • Tissue specificity: Ubiquitously expressed. Highest levels in heart, placenta, skeletal muscle and pancreas. Lower levels in brain, lung and kidney. In the brain, expressed in all regions with high levels in the cerebellum and cerebral cortex. Expressed i
• Sequence:

  MNRLPDDYDPYAVEEPSDEEPALSSSEDEVDVLLHGTPDQKRKLIRECLTGESESSSEDEFEKEMEAELNSTMKT
  MEDKLSSLGTGSSSGNGKVATAPTRYYDDIYFDSDSEDEDRAVQVTKKKKKKQHKIPTNDELLYDPEKDNRDQAW
  VDAQRRGYHGLGPQRSRQQQPVPNSDAVLNCPACMTTLCLDCQRHESYKTQYRAMFVMNCSINKEEVLRYKASEN
  RKKRRVHKKMRSNREDAAEKAETDVEEIYHPVMCTECSTEVAVYDKDEVFHFFNVLASHS

• Structural information:
  • Interpro: IPR019370  
  • STRING: ENSP00000250454
• Other Databases: GeneCards:  EAPP  Malacards:  EAPP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008284	positive regulation of cell population proliferation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0034244	negative regulation of transcription elongation from RNA polymerase II promoter	IDA	biological process
GO:0032968	positive regulation of transcription elongation from RNA polymerase II promoter	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881