• Gene id: 5583

Gene Summary

• Gene Symbol: PRKCH   Gene   UCSC   Ensembl
• Aliases: PKC-L, PKCL, PRKCL, nPKC-eta
• Gene name: protein kinase C eta
• Alternate names: protein kinase C eta type,
• Gene location: 14q23.1 (61187304: 61550979)     Exons: 23     NC_000014.9
• Gene summary(Entrez): Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved
• OMIM: 605437

Protein Summary

• Protein general information: P24723  
  • Name: Protein kinase C eta type (EC 2.7.11.13) (PKC L) (nPKC eta)
  • Length: 683  
  • Mass: 77828
  • Tissue specificity: Most abundant in lung, less in heart and skin. {ECO
• Sequence:

  MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTKQKTNKPTYNEEFCAN
  VTDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTTGASDTFEGWVDLEPEGKVFVVITLTGSFTEATLQRDRI
  FKHFTRKRQRAMRRRVHQINGHKFMATYLRQPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQ
  NNINKVDSKIAEQRFGINIPHKFSIHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCGVNAV
  ELAKTLAGMGLQPGNISPTSKLVSRSTLRRQGKESSKEGNGIGVNSSNRLGIDNFEFIRVLGKGSFGKVMLARVK
  ETGDLYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLFCCFQTPDRLFFVMEFVNGGDLMFHIQKSRR
  FDEARARFYAAEIISALMFLHDKGIIYRDLKLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEI
  LQEMLYGPAVDWWAMGVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSL
  TQGGEHAILRHPFFKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDEGHLPMINQDEFRNFS
  YVSPELQP

• Structural information:
  • Protein Domains: (1..11-)
    (/note="C2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (355..61-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (615..68-)
    (/note="AGC-kinase-C-terminal")
  • Interpro: IPR000961  IPR000008  IPR035892  IPR020454  IPR011009   IPR034665  IPR002219  IPR027431  IPR017892  IPR014376  IPR000719  IPR017441  IPR008271  
  • Prosite: PS51285 PS50004 PS00107 PS50011 PS00108 PS00479 PS50081
  • CDD: cd00029 cd05590
  • PDB: 2FK9 3TXO
  • PDBsum: 2FK9 3TXO
  • DIP: 44588
  • STRING: ENSP00000329127
• Other Databases: GeneCards:  PRKCH  Malacards:  PRKCH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1903078	positive regulation of protein localization to plasma membrane	TAS	biological process
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0060252	positive regulation of glial cell proliferation	IMP	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0045618	positive regulation of keratinocyte differentiation	ISS	biological process
GO:0034351	negative regulation of glial cell apoptotic process	IMP	biological process
GO:0010744	positive regulation of macrophage derived foam cell differentiation	ISS	biological process
GO:0005829	cytosol	ISS	cellular component
GO:2000810	regulation of bicellular tight junction assembly	IMP	biological process
GO:0050861	positive regulation of B cell receptor signaling pathway	IMP	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0006468	protein phosphorylation	IMP	biological process
GO:0004697	protein kinase C activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004697	protein kinase C activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0004698	calcium-dependent protein kinase C activity	IEA	molecular function
GO:0004697	protein kinase C activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0030168	platelet activation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04270	Vascular smooth muscle contraction
hsa04750	Inflammatory mediator regulation of TRP channels
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq