• Gene id: 55829

Gene Summary

• Gene Symbol: SELENOS   Gene   UCSC   Ensembl
• Aliases: AD-015, ADO15, SBBI8, SELS, SEPS1, VIMP
• Gene name: selenoprotein S
• Alternate names: selenoprotein S, VCP interacting membrane selenoprotein, VCP-interacting membrane protein, tanis, valosin-containing protein-interacting membrane protein,
• Gene location: 15q26.3 (101277484: 101270808)     Exons: 7     NC_000015.10
• Gene summary(Entrez): This gene encodes a transmembrane protein that is localized in the endoplasmic reticulum (ER). It is involved in the degradation process of misfolded proteins in the ER, and may also have a role in inflammation control. This protein is a selenoprotein, co
• OMIM: 607918

Protein Summary

• Protein general information: Q9BQE4  
  • Name: Selenoprotein S (SelS) (VCP interacting membrane protein)
  • Length: 189  
  • Mass: 21163
• Sequence:

  MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAVEPDVV
  VKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLK
  RKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG

• Structural information:
  • Interpro: IPR009703  
  • PDB: 2Q2F 5KIU 5KIY 6DO4
  • PDBsum: 2Q2F 5KIU 5KIY 6DO4
  • STRING: ENSP00000381282
• Other Databases: GeneCards:  SELENOS  Malacards:  SELENOS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0036502	Derlin-1-VIMP complex	IDA	cellular component
GO:1990381	ubiquitin-specific protease binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0036513	Derlin-1 retrotranslocation complex	IDA	cellular component
GO:0051117	ATPase binding	IPI	molecular function
GO:0030433	ubiquitin-dependent ERAD pathway	IBA	biological process
GO:0030970	retrograde protein transport, ER to cytosol	IBA	biological process
GO:0036513	Derlin-1 retrotranslocation complex	IBA	cellular component
GO:0030176	integral component of endoplasmic reticulum membrane	IBA	cellular component
GO:0030968	endoplasmic reticulum unfolded protein response	IBA	biological process
GO:0036502	Derlin-1-VIMP complex	IBA	cellular component
GO:0005881	cytoplasmic microtubule	IDA	cellular component
GO:0030176	integral component of endoplasmic reticulum membrane	IEA	cellular component
GO:0006886	intracellular protein transport	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016567	protein ubiquitination	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032720	negative regulation of tumor necrosis factor production	IEA	biological process
GO:0032715	negative regulation of interleukin-6 production	IEA	biological process
GO:0006983	ER overload response	IDA	biological process
GO:0034362	low-density lipoprotein particle	IDA	cellular component
GO:0034361	very-low-density lipoprotein particle	IDA	cellular component
GO:0050728	negative regulation of inflammatory response	IC	biological process
GO:0006983	ER overload response	IMP	biological process
GO:0009749	response to glucose	IEP	biological process
GO:0032720	negative regulation of tumor necrosis factor production	ISS	biological process
GO:0032869	cellular response to insulin stimulus	TAS	biological process
GO:0034599	cellular response to oxidative stress	IMP	biological process
GO:0051771	negative regulation of nitric-oxide synthase biosynthetic process	IMP	biological process
GO:0071222	cellular response to lipopolysaccharide	IMP	biological process
GO:1902236	negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IMP	biological process
GO:0002865	negative regulation of acute inflammatory response to antigenic stimulus	IMP	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0006111	regulation of gluconeogenesis	TAS	biological process
GO:0032715	negative regulation of interleukin-6 production	ISS	biological process
GO:0045719	negative regulation of glycogen biosynthetic process	TAS	biological process
GO:0046325	negative regulation of glucose import	TAS	biological process
GO:0080164	regulation of nitric oxide metabolic process	IMP	biological process
GO:2000110	negative regulation of macrophage apoptotic process	IMP	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0045454	cell redox homeostasis	IDA	biological process
GO:0030968	endoplasmic reticulum unfolded protein response	IDA	biological process
GO:0030176	integral component of endoplasmic reticulum membrane	IDA	cellular component
GO:0051775	response to redox state	IDA	biological process
GO:0030970	retrograde protein transport, ER to cytosol	IDA	biological process
GO:0030433	ubiquitin-dependent ERAD pathway	IDA	biological process
GO:0016209	antioxidant activity	IDA	molecular function
GO:0045184	establishment of protein localization	TAS	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0009749	response to glucose	IEP	biological process
GO:0038023	signaling receptor activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)