• Gene id: 55824

Gene Summary

• Gene Symbol: PAG1   Gene   UCSC   Ensembl
• Aliases: CBP, PAG
• Gene name: phosphoprotein membrane anchor with glycosphingolipid microdomains 1
• Alternate names: phosphoprotein associated with glycosphingolipid-enriched microdomains 1, Csk-binding protein, phosphoprotein associated with glycosphingolipid microdomains 1, transmembrane adapter protein PAG, transmembrane adaptor protein PAG, transmembrane phosphoprotein C,
• Gene location: 8q21.13 (81112067: 80967809)     Exons: 11     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene is a type III transmembrane adaptor protein that binds to the tyrosine kinase csk protein. It is thought to be involved in the regulation of T cell activation. [provided by RefSeq, Jul 2008]
• OMIM: 616966

Protein Summary

• Protein general information: Q9NWQ8  
  • Name: Phosphoprotein associated with glycosphingolipid enriched microdomains 1 (Csk binding protein) (Transmembrane adapter protein PAG) (Transmembrane phosphoprotein Cbp)
  • Length: 432  
  • Mass: 46981
  • Tissue specificity: Ubiquitously expressed. Present in germinal center B-cells, plasma cells, T-cells, monocytes and platelets (at protein level). {ECO
• Sequence:

  MGPAGSLLGSGQMQITLWGSLAAVAIFFVITFLIFLCSSCDREKKPRQHSGDHENLMNVPSDKEMFSRSVTSLAT
  DAPASSEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKPKCHQSRELPRIPPESAVDTMLTARS
  VDGDQGLGMEGPYEVLKDSSSQENMVEDCLYETVKEIKEVAAAAHLEKGHSGKAKSTSASKELPGPQTEGKAEFA
  EYASVDRNKKCRQSVNVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAEESATDTTSETNKRFSSLSYK
  SREEDPTLTEEEISAMYSSVNKPGQLVNKSGQSLTVPESTYTSIQGDPQRSPSSCNDLYATVKDFEKTPNSTLPP
  AGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYESISDLQQGRDITRL

• Structural information:
  • Interpro: IPR032748  
  • STRING: ENSP00000220597
• Other Databases: GeneCards:  PAG1  Malacards:  PAG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0035591	signaling adaptor activity	NAS	molecular function
GO:0042169	SH2 domain binding	IDA	molecular function
GO:0045121	membrane raft	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0045121	membrane raft	IBA	cellular component
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0042169	SH2 domain binding	IBA	molecular function
GO:0050868	negative regulation of T cell activation	IBA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0050868	negative regulation of T cell activation	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0050863	regulation of T cell activation	IDA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050868	negative regulation of T cell activation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881