• Gene id: 5582

Gene Summary

• Gene Symbol: PRKCG   Gene   UCSC   Ensembl
• Aliases: PKC-gamma, PKCC, PKCG, PKCI(3), PKCgamma, SCA14
• Gene name: protein kinase C gamma
• Alternate names: protein kinase C gamma type,
• Gene location: 19q13.42 (53882196: 53907651)     Exons: 18     NC_000019.10
• Gene summary(Entrez): Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in d
• OMIM: 607097

Protein Summary

• Protein general information: P05129  
  • Name: Protein kinase C gamma type (PKC gamma) (EC 2.7.11.13)
  • Length: 697  
  • Mass: 78448
  • Tissue specificity: Expressed in Purkinje cells of the cerebellar cortex. {ECO
• Sequence:

  MAGLGPGVGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIGKQGLQCQVCSFVVHR
  RCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHRRCVRSVPSLC
  GVDHTERRGRLQLEIRAPTADEIHVTVGEARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNE
  TFVFNLKPGDVERRLSVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
  KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISDFSFLMVLGKGSFGKVMLAERRGSDE
  LYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQLHSTFQTPDRLYFVMEYVTGGDLMYHIQQLG
  KFKEPHAAFYAAEIAIGLFFLHNQGIIYRDLKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPE
  IIAYQPYGKSVDWWSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGS
  GPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTY
  VNPDFVHPDARSPTSPVPVPVM

• Structural information:
  • Protein Domains: (157..27-)
    (/note="C2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (351..61-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (615..68-)
    (/note="AGC-kinase-C-terminal")
  • Interpro: IPR000961  IPR000008  IPR035892  IPR020454  IPR011009   IPR002219  IPR017892  IPR000719  IPR017441  IPR014375  IPR008271  
  • Prosite: PS51285 PS50004 PS00107 PS50011 PS00108 PS00479 PS50081
  • CDD: cd00029
  • PDB: 2E73 2UZP
  • PDBsum: 2E73 2UZP
  • DIP: 39795
  • STRING: ENSP00000263431
• Other Databases: GeneCards:  PRKCG  Malacards:  PRKCG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042177	negative regulation of protein catabolic process	IDA	biological process
GO:0004672	protein kinase activity	IDA	molecular function
GO:0031397	negative regulation of protein ubiquitination	IDA	biological process
GO:0016310	phosphorylation	IDA	biological process
GO:0032425	positive regulation of mismatch repair	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0032095	regulation of response to food	ISS	biological process
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0043278	response to morphine	ISS	biological process
GO:0030425	dendrite	ISS	cellular component
GO:0005829	cytosol	ISS	cellular component
GO:1901799	negative regulation of proteasomal protein catabolic process	ISS	biological process
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0048265	response to pain	ISS	biological process
GO:0043524	negative regulation of neuron apoptotic process	ISS	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0004697	protein kinase C activity	IEA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0048511	rhythmic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0004697	protein kinase C activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0004697	protein kinase C activity	IEA	molecular function
GO:0004698	calcium-dependent protein kinase C activity	IEA	molecular function
GO:0004712	protein serine/threonine/tyrosine kinase activity	IDA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0030168	platelet activation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005911	cell-cell junction	IEA	cellular component
GO:0007268	chemical synaptic transmission	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0031397	negative regulation of protein ubiquitination	IEA	biological process
GO:0032095	regulation of response to food	IEA	biological process
GO:0043278	response to morphine	IEA	biological process
GO:0099171	presynaptic modulation of chemical synaptic transmission	IEA	biological process
GO:0099523	presynaptic cytosol	IEA	cellular component
GO:2000300	regulation of synaptic vesicle exocytosis	IEA	biological process
GO:0004697	protein kinase C activity	IEA	molecular function
GO:0004698	calcium-dependent protein kinase C activity	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0007611	learning or memory	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0046777	protein autophosphorylation	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:1990911	response to psychosocial stress	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007635	chemosensory behavior	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0042752	regulation of circadian rhythm	IEA	biological process
GO:0044305	calyx of Held	IEA	cellular component
GO:0048265	response to pain	IEA	biological process
GO:0050764	regulation of phagocytosis	IEA	biological process
GO:0060384	innervation	IEA	biological process
GO:0097060	synaptic membrane	IEA	cellular component
GO:1901799	negative regulation of proteasomal protein catabolic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0099524	postsynaptic cytosol	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04010	MAPK signaling pathway
hsa05206	MicroRNAs in cancer
hsa04014	Ras signaling pathway
hsa04015	Rap1 signaling pathway
hsa05163	Human cytomegalovirus infection
hsa04020	Calcium signaling pathway
hsa04510	Focal adhesion
hsa05170	Human immunodeficiency virus 1 infection
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04150	mTOR signaling pathway
hsa04723	Retrograde endocannabinoid signaling
hsa05225	Hepatocellular carcinoma
hsa05017	Spinocerebellar ataxia
hsa04921	Oxytocin signaling pathway
hsa05161	Hepatitis B
hsa04728	Dopaminergic synapse
hsa04724	Glutamatergic synapse
hsa04270	Vascular smooth muscle contraction
hsa04071	Sphingolipid signaling pathway
hsa04725	Cholinergic synapse
hsa04670	Leukocyte transendothelial migration
hsa04070	Phosphatidylinositol signaling system
hsa04935	Growth hormone synthesis, secretion and action
hsa04919	Thyroid hormone signaling pathway
hsa04726	Serotonergic synapse
hsa04650	Natural killer cell mediated cytotoxicity
hsa04916	Melanogenesis
hsa05231	Choline metabolism in cancer
hsa05032	Morphine addiction
hsa04727	GABAergic synapse
hsa04713	Circadian entrainment
hsa04925	Aldosterone synthesis and secretion
hsa04928	Parathyroid hormone synthesis, secretion and action
hsa04972	Pancreatic secretion
hsa04666	Fc gamma R-mediated phagocytosis
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04066	HIF-1 signaling pathway
hsa04970	Salivary secretion
hsa04911	Insulin secretion
hsa04540	Gap junction
hsa04012	ErbB signaling pathway
hsa05146	Amoebiasis
hsa04971	Gastric acid secretion
hsa04918	Thyroid hormone synthesis
hsa04720	Long-term potentiation
hsa05031	Amphetamine addiction
hsa05214	Glioma
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa04961	Endocrine and other factor-regulated calcium reabsorption
hsa05223	Non-small cell lung cancer
hsa04929	GnRH secretion
hsa04730	Long-term depression
hsa04370	VEGF signaling pathway
hsa04960	Aldosterone-regulated sodium reabsorption
hsa05143	African trypanosomiasis

Diseases

Associated diseases	References
Spinocerebellar ataxia	KEGG:H00063
Spinocerebellar ataxia	KEGG:H00063
Cerebral infarction	PMID:14688616
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray