• Gene id: 5581

Gene Summary

• Gene Symbol: PRKCE   Gene   UCSC   Ensembl
• Aliases: PKCE, nPKC-epsilon
• Gene name: protein kinase C epsilon
• Alternate names: protein kinase C epsilon type,
• Gene location: 2p21 (45651314: 46187989)     Exons: 32     NC_000002.12
• Gene summary(Entrez): Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved
• OMIM: 602781

SNPs

rs779944215

Strand:    Allele origin:   Allele change:   Mutation type: delins

NC_000001.11   g.167880125_167880126GT[1]
NC_000001.10   g.167849363_167849364GT[1]
NG_016139.1   g.39088_39089AC[1]
NM_018417.6   c.1203_1204AC[1]
NM_018417.5   c.1203_1204AC[1]
NM_018417.4   c.1203_1204AC[1]
NM_001167749.3   c.744_745AC[1]
NM_001167749.2   c.744_7

rs34605051

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000002.12   g.86466703T>C
NC_000002.11   g.86693826T>C
NG_047167.1   g.31057T>C
NM_018433.6   c.1339T>C
NM_018433.5   c.1339T>C
NM_001146688.1   c.1339T>C
XM_006712051.4   c.-637T>C
XM_024452995.1   c.1339T>C
XM_024452994.1   c.1339T>C
XM_017004494.1   c.484T>C
XM_02  

Protein Summary

• Protein general information: Q02156  
  • Name: Protein kinase C epsilon type (EC 2.7.11.13) (nPKC epsilon)
  • Length: 737  
  • Mass: 83674
• Sequence:

  MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKTNSPAWHDEFVTDVCN
  GRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLEPEGRVYVIIDLSGSSGEAPKDNEERVFRER
  MRPRKRQGAVRRRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKK
  QETPDQVGSQRFSVNMPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIA
  KVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEE
  HRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDV
  DCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQ
  HGVIYRDLKLDNILLDAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEM
  MAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVL
  LEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP

• Structural information:
  • Protein Domains: (1..11-)
    (/note="C2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (408..66-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (669..73-)
    (/note="AGC-kinase-C-terminal")
  • Interpro: IPR000961  IPR000008  IPR035892  IPR020454  IPR011009   IPR034669  IPR002219  IPR027274  IPR017892  IPR014376  IPR000719  IPR017441  IPR008271  
  • Prosite: PS51285 PS50004 PS00107 PS50011 PS00108 PS00479 PS50081
  • CDD: cd00029 cd05591
  • PDB: 2WH0 5LIH
  • PDBsum: 2WH0 5LIH
  • DIP: 34186
  • STRING: ENSP00000306124
• Other Databases: GeneCards:  PRKCE  Malacards:  PRKCE

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1903078	positive regulation of protein localization to plasma membrane	TAS	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0090303	positive regulation of wound healing	IMP	biological process
GO:0071944	cell periphery	ISS	cellular component
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0035669	TRAM-dependent toll-like receptor 4 signaling pathway	ISS	biological process
GO:0010634	positive regulation of epithelial cell migration	IMP	biological process
GO:0005794	Golgi apparatus	ISS	colocalizes with
GO:0003785	actin monomer binding	ISS	molecular function
GO:0032467	positive regulation of cytokinesis	IMP	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	ISS	biological process
GO:0030838	positive regulation of actin filament polymerization	ISS	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0010763	positive regulation of fibroblast migration	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004697	protein kinase C activity	IEA	molecular function
GO:0004699	calcium-independent protein kinase C activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0004697	protein kinase C activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0004697	protein kinase C activity	IEA	molecular function
GO:0004698	calcium-dependent protein kinase C activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0030168	platelet activation	TAS	biological process
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071361	cellular response to ethanol	IEA	biological process
GO:0061178	regulation of insulin secretion involved in cellular response to glucose stimulus	IEA	biological process
GO:0051279	regulation of release of sequestered calcium ion into cytosol	IEA	biological process
GO:0050996	positive regulation of lipid catabolic process	IEA	biological process
GO:0050730	regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0032230	positive regulation of synaptic transmission, GABAergic	IEA	biological process
GO:0032024	positive regulation of insulin secretion	IEA	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IEA	biological process
GO:0030838	positive regulation of actin filament polymerization	IEA	biological process
GO:0030546	signaling receptor activator activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0010763	positive regulation of fibroblast migration	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0002281	macrophage activation involved in immune response	IEA	biological process
GO:0071944	cell periphery	IEA	cellular component
GO:0071889	14-3-3 protein binding	IEA	molecular function
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0071380	cellular response to prostaglandin E stimulus	IEA	biological process
GO:0070257	positive regulation of mucus secretion	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0043278	response to morphine	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0035669	TRAM-dependent toll-like receptor 4 signaling pathway	IEA	biological process
GO:0035641	locomotory exploration behavior	IEA	biological process
GO:0035276	ethanol binding	IEA	molecular function
GO:0031397	negative regulation of protein ubiquitination	IEA	biological process
GO:0019216	regulation of lipid metabolic process	IEA	biological process
GO:0010811	positive regulation of cell-substrate adhesion	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0004699	calcium-independent protein kinase C activity	IEA	molecular function
GO:0003785	actin monomer binding	IEA	molecular function
GO:2000650	negative regulation of sodium ion transmembrane transporter activity	TAS	biological process
GO:0004697	protein kinase C activity	IDA	molecular function
GO:0019899	enzyme binding	IDA	molecular function
GO:0008047	enzyme activator activity	IMP	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:2001031	positive regulation of cellular glucuronidation	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:1903078	positive regulation of protein localization to plasma membrane	TAS	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0090303	positive regulation of wound healing	IMP	biological process
GO:0071944	cell periphery	ISS	cellular component
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0035669	TRAM-dependent toll-like receptor 4 signaling pathway	ISS	biological process
GO:0010634	positive regulation of epithelial cell migration	IMP	biological process
GO:0005794	Golgi apparatus	ISS	colocalizes with
GO:0003785	actin monomer binding	ISS	molecular function
GO:0032467	positive regulation of cytokinesis	IMP	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	ISS	biological process
GO:0030838	positive regulation of actin filament polymerization	ISS	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0010763	positive regulation of fibroblast migration	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004697	protein kinase C activity	IEA	molecular function
GO:0004699	calcium-independent protein kinase C activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0004697	protein kinase C activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0004697	protein kinase C activity	IEA	molecular function
GO:0004698	calcium-dependent protein kinase C activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0030168	platelet activation	TAS	biological process
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071361	cellular response to ethanol	IEA	biological process
GO:0061178	regulation of insulin secretion involved in cellular response to glucose stimulus	IEA	biological process
GO:0051279	regulation of release of sequestered calcium ion into cytosol	IEA	biological process
GO:0050996	positive regulation of lipid catabolic process	IEA	biological process
GO:0050730	regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0032230	positive regulation of synaptic transmission, GABAergic	IEA	biological process
GO:0032024	positive regulation of insulin secretion	IEA	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IEA	biological process
GO:0030838	positive regulation of actin filament polymerization	IEA	biological process
GO:0030546	signaling receptor activator activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0010763	positive regulation of fibroblast migration	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0002281	macrophage activation involved in immune response	IEA	biological process
GO:0071944	cell periphery	IEA	cellular component
GO:0071889	14-3-3 protein binding	IEA	molecular function
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0071380	cellular response to prostaglandin E stimulus	IEA	biological process
GO:0070257	positive regulation of mucus secretion	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0043278	response to morphine	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0035669	TRAM-dependent toll-like receptor 4 signaling pathway	IEA	biological process
GO:0035641	locomotory exploration behavior	IEA	biological process
GO:0035276	ethanol binding	IEA	molecular function
GO:0031397	negative regulation of protein ubiquitination	IEA	biological process
GO:0019216	regulation of lipid metabolic process	IEA	biological process
GO:0010811	positive regulation of cell-substrate adhesion	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0004699	calcium-independent protein kinase C activity	IEA	molecular function
GO:0003785	actin monomer binding	IEA	molecular function
GO:2000650	negative regulation of sodium ion transmembrane transporter activity	TAS	biological process
GO:0004697	protein kinase C activity	IDA	molecular function
GO:0019899	enzyme binding	IDA	molecular function
GO:0008047	enzyme activator activity	IMP	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:2001031	positive regulation of cellular glucuronidation	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05206	MicroRNAs in cancer
hsa05131	Shigellosis
hsa04022	cGMP-PKG signaling pathway
hsa04530	Tight junction
hsa04371	Apelin signaling pathway
hsa04270	Vascular smooth muscle contraction
hsa04071	Sphingolipid signaling pathway
hsa04925	Aldosterone synthesis and secretion
hsa04931	Insulin resistance
hsa04666	Fc gamma R-mediated phagocytosis
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa04930	Type II diabetes mellitus
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray