• Gene id: 55808

Gene Summary

• Gene Symbol: ST6GALNAC1   Gene   UCSC   Ensembl
• Aliases: HSY11339, SIAT7A, ST6GalNAcI, STYI
• Gene name: ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
• Alternate names: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1, GalNAc alpha-2, 6-sialyltransferase I, long form, SIAT7-A, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1, ST6 GalNAc alpha-2,6-sialylt,
• Gene location: 17q25.1 (76643757: 76617768)     Exons: 12     NC_000017.11
• Gene summary(Entrez): Glycosylation of proteins affects cell-cell interaction, interactions with the matrix, and the functions of intracellular molecules. ST6GALNAC1 transfers a sialic acid, N-acetylneuraminic acid (NeuAc), in an alpha-2,6 linkage to O-linked GalNAc residues.
• OMIM: 618538

Protein Summary

• Protein general information: Q9NSC7  
  • Name: Alpha N acetylgalactosaminide alpha 2,6 sialyltransferase 1 (EC 2.4.99.3) (GalNAc alpha 2,6 sialyltransferase I) (ST6GalNAc I) (ST6GalNAcI) (Sialyltransferase 7A) (SIAT7 A)
  • Length: 600  
  • Mass: 68564
• Sequence:

  MRSCLWRCRHLSQGVQWSLLLAVLVFFLFALPSFIKEPQTKPSRHQRTENIKERSLQSLAKPKSQAPTRARRTTI
  YAEPVPENNALNTQTQPKAHTTGDRGKEANQAPPEEQDKVPHTAQRAAWKSPEKEKTMVNTLSPRGQDAGMASGR
  TEAQSWKSQDTKTTQGNGGQTRKLTASRTVSEKHQGKAATTAKTLIPKSQHRMLAPTGAVSTRTRQKGVTTAVIP
  PKEKKPQATPPPAPFQSPTTQRNQRLKAANFKSEPRWDFEEKYSFEIGGLQTTCPDSVKIKASKSLWLQKLFLPN
  LTLFLDSRHFNQSEWDRLEHFAPPFGFMELNYSLVQKVVTRFPPVPQQQLLLASLPAGSLRCITCAVVGNGGILN
  NSHMGQEIDSHDYVFRLSGALIKGYEQDVGTRTSFYGFTAFSLTQSLLILGNRGFKNVPLGKDVRYLHFLEGTRD
  YEWLEALLMNQTVMSKNLFWFRHRPQEAFREALHMDRYLLLHPDFLRYMKNRFLRSKTLDGAHWRIYRPTTGALL
  LLTALQLCDQVSAYGFITEGHERFSDHYYDTSWKRLIFYINHDFKLEREVWKRLHDEGIIRLYQRPGPGTAKAKN

• Structural information:
  • Interpro: IPR001675  IPR038578  
  • STRING: ENSP00000156626
• Other Databases: GeneCards:  ST6GALNAC1  Malacards:  ST6GALNAC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001665	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	IBA	molecular function
GO:0006486	protein glycosylation	IEA	biological process
GO:0008373	sialyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0001665	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	IEA	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0009312	oligosaccharide biosynthetic process	IEA	biological process
GO:0001665	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	IEA	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0008373	sialyltransferase activity	NAS	molecular function
GO:0006486	protein glycosylation	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00512	Mucin type O-glycan biosynthesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881