• Gene id: 55803

Gene Summary

• Gene Symbol: ADAP2   Gene   UCSC   Ensembl
• Aliases: CENTA2, HSA272195, cent-b
• Gene name: ArfGAP with dual PH domains 2
• Alternate names: arf-GAP with dual PH domain-containing protein 2, centaurin beta, centaurin-alpha 2 protein,
• Gene location: 17q11.2 (30921735: 30959397)     Exons: 11     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene binds beta-tubulin and increases the stability of microtubules. The encoded protein can also translocate to the cell membrane and bind phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and inositol 1,3,4,5-tetrakisphosph
• OMIM: 608635

Protein Summary

• Protein general information: Q9NPF8  
  • Name: Arf GAP with dual PH domain containing protein 2 (Centaurin alpha 2) (Cnt a2)
  • Length: 381  
  • Mass: 44349
  • Tissue specificity: Highly expressed in placenta, spleen, kidney, skeletal muscle and adrenal gland. Weakly expressed in thyroid, liver, heart, lung, small intestine, peripheral blood leukocytes. Not detected in spinal cord, brain, stomach, trachea, colon
• Sequence:

  MGDRERNKKRLLELLRAPDTGNAHCADCGAADPDWASYKLGIFICLNCCGVHRNFPDISRVKSVRLDFWDDSIVE
  FMIHNGNLRVKAKFEARVPAFYYIPQANDCLVLKEQWIRAKYERREFMADGETISLPGNREGFLWKRGRDNSQFL
  RRKFVLLAREGLLKYFTKEQGKSPKAVISIKDLNATFQTEKIGHPHGLQITYRRDGHTRNLFVYHESGKEIVDWF
  NALRAARLQYLKMAFPELPESELVPFLTRNYLKQGFMEKTGPKQKEPFKKRWFALDCHERRLLYYKNPLDAFEQG
  QVFLGNKEQGYEAYEDLPKGIRGNRWKAGLTIVTPERRFVLTCPSEKEQQEWLESLRGVLSSPLTPLNRLTASTE
  SGRSSR

• Structural information:
  • Protein Domains: (9..13-)
    (/note="Arf-GAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00288-)
    (132..23-)
    (/note="PH-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (255..36-)
    (/note="PH-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145"-)
  • Interpro: IPR037278  IPR001164  IPR038508  IPR011993  IPR037849   IPR037851  IPR001849  
  • Prosite: PS50115 PS50003
  • CDD: cd13252 cd01251
  • STRING: ENSP00000329468
• Other Databases: GeneCards:  ADAP2  Malacards:  ADAP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:1902936	phosphatidylinositol bisphosphate binding	IEA	molecular function
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0048017	inositol lipid-mediated signaling	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0043533	inositol 1,3,4,5 tetrakisphosphate binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding	IDA	molecular function
GO:0005740	mitochondrial envelope	ISS	cellular component
GO:0043325	phosphatidylinositol-3,4-bisphosphate binding	ISS	molecular function
GO:0030674	protein-macromolecule adaptor activity	NAS	molecular function
GO:0007507	heart development	IEP	biological process
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	ISS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq