Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 55802
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol DCP1A   Gene   UCSC   Ensembl
Aliases HSA275986, Nbla00360, SMAD4IP1, SMIF
Gene name decapping mRNA 1A
Alternate names mRNA-decapping enzyme 1A, DCP1 decapping enzyme homolog A, DCP1 decapping enzyme-like protein A, Smad4-interacting transcriptional co-activator, decapping enzyme hDcp1a, putative protein product of Nbla00360, transcription factor SMIF,
Gene location 3p21.1 (53347542: 53283428)     Exons: 11     NC_000003.12
Gene summary(Entrez) Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may
OMIM 112266

Protein Summary
Protein general information Q9NPI6  

Name: mRNA decapping enzyme 1A (EC 3. . . ) (Smad4 interacting transcriptional co activator) (Transcription factor SMIF)

Length: 582  Mass: 63278

Tissue specificity: Detected in heart, brain, placenta, lung, skeletal muscle, liver, kidney and pancreas. {ECO

Sequence MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNM
HNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCS
DHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGT
SLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASIT
QSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPRQRSPLLNQPVPELSHASLIANQSPF
RAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASA
SLSNMVLAPLQSMQQNQDPEVFVQPKVLSSAIPVAGAPLVTATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPS
PLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL
Structural information
Interpro:  IPR010334  IPR031953  IPR011993  

PDB:  		 2WX3 4B6H
PDBsum:   2WX3 4B6H

DIP:  
31292
MINT:  
STRING:   ENSP00000476046
Other Databases GeneCards:  DCP1A  Malacards:  DCP1A

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0031087 deadenylation-independent
decapping of nuclear-tra
nscribed mRNA
 IBA biological process
GO:0030234 enzyme regulator activity
 IBA molecular function
GO:0003729 mRNA binding
 IBA molecular function
GO:0000932 P-body
 IBA cellular component
GO:0000290 deadenylation-dependent d
ecapping of nuclear-trans
cribed mRNA
 IBA biological process
GO:0000932 P-body
 ISS cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0000290 deadenylation-dependent d
ecapping of nuclear-trans
cribed mRNA
 IEA biological process
GO:0008047 enzyme activator activity
 IEA molecular function
GO:0043085 positive regulation of ca
talytic activity
 IEA biological process
GO:0016787 hydrolase activity
 IEA molecular function
GO:0000184 nuclear-transcribed mRNA
catabolic process, nonsen
se-mediated decay
 IEA biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:1903608 protein localization to c
ytoplasmic stress granule
 IMP biological process
GO:0043928 exonucleolytic catabolism
of deadenylated mRNA
 TAS biological process
GO:0000184 nuclear-transcribed mRNA
catabolic process, nonsen
se-mediated decay
 TAS biological process
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0043488 regulation of mRNA stabil
ity
 TAS biological process
GO:0043488 regulation of mRNA stabil
ity
 TAS biological process
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0000932 P-body
 IEA cellular component
GO:0019894 kinesin binding
 IEA molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0000932 P-body
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0036464 cytoplasmic ribonucleopro
tein granule
 IDA cellular component
GO:0016020 membrane
 HDA cellular component
GO:0031087 deadenylation-independent
decapping of nuclear-tra
nscribed mRNA
 IBA biological process
GO:0030234 enzyme regulator activity
 IBA molecular function
GO:0003729 mRNA binding
 IBA molecular function
GO:0000932 P-body
 IBA cellular component
GO:0000290 deadenylation-dependent d
ecapping of nuclear-trans
cribed mRNA
 IBA biological process
GO:0000932 P-body
 ISS cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0000290 deadenylation-dependent d
ecapping of nuclear-trans
cribed mRNA
 IEA biological process
GO:0008047 enzyme activator activity
 IEA molecular function
GO:0043085 positive regulation of ca
talytic activity
 IEA biological process
GO:0016787 hydrolase activity
 IEA molecular function
GO:0000184 nuclear-transcribed mRNA
catabolic process, nonsen
se-mediated decay
 IEA biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:1903608 protein localization to c
ytoplasmic stress granule
 IMP biological process
GO:0043928 exonucleolytic catabolism
of deadenylated mRNA
 TAS biological process
GO:0000184 nuclear-transcribed mRNA
catabolic process, nonsen
se-mediated decay
 TAS biological process
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0043488 regulation of mRNA stabil
ity
 TAS biological process
GO:0043488 regulation of mRNA stabil
ity
 TAS biological process
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0000932 P-body
 IEA cellular component
GO:0019894 kinesin binding
 IEA molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0000932 P-body
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0036464 cytoplasmic ribonucleopro
tein granule
 IDA cellular component
GO:0016020 membrane
 HDA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa03018RNA degradation

Diseases

Expand All | Collapse All
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract
28606200 Cryptorchi
dism
Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
 Male infertility MeDIP-Seq
 Show abstract