• Gene id: 55801

Gene Summary

• Gene Symbol: IL26   Gene   UCSC   Ensembl
• Aliases: AK155, IL-26
• Gene name: interleukin 26
• Alternate names: interleukin-26,
• Gene location: 12q15 (68225809: 68201348)     Exons: 5     NC_000012.12
• Gene summary(Entrez): This gene was identified by its overexpression specifically in herpesvirus samimiri-transformed T cells. The encoded protein is a member of the IL10 family of cytokines. It is a secreted protein and may function as a homodimer. This protein is thought to

Protein Summary

• Protein general information: Q9NPH9  
  • Name: Interleukin 26 (IL 26) (Protein AK155)
  • Length: 171  
  • Mass: 19843
  • Tissue specificity: Expressed in HVS transformed T-cells but not other T-cell lines or primary stimulated T-cells. Expressed in colonic T-cells including Th17 inflammatory T-cells; the expression is significantly increased in serum of patients with Crohn'
• Sequence:

  MLVNFILRCGLLLVTLSLAIAKHKQSSFTKSCYPRGTLSQAVDALYIKAAWLKATIPEDRIKNIRLLKKKTKKQF
  MKNCQFQEQLLSFFMEDVFGQLQLQGCKKIRFVEDFHSLRQKLSHCISCASSAREMKSITRMKRIFYRIGNKGIY
  KAISELDILLSWIKKLLESSQ

• Structural information:
  • Interpro: IPR009079  IPR020443  IPR020423  
  • Prosite: PS00520
  • STRING: ENSP00000229134
• Other Databases: GeneCards:  IL26  Malacards:  IL26

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0050715	positive regulation of cytokine secretion	IDA	biological process
GO:0050680	negative regulation of epithelial cell proliferation	IDA	biological process
GO:0032874	positive regulation of stress-activated MAPK cascade	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005125	cytokine activity	IDA	molecular function
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0046427	positive regulation of receptor signaling pathway via JAK-STAT	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray